SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCR067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR067C
Domain Number 1 Region: 11-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-23
Family Cell cycle arrest protein BUB3 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
cytoplasmic vesicle part 1.417 9.77
endosome 1.351 9.77
endosome membrane 1.934 9.77

Protein sequence

External link(s) Locus: YCR067C   Protein: S000000663
Sequence length 1065
Comment SED4 SGDID:S000000663, Chr III from 236318-233121, reverse complement, Verified ORF, "Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p"
Sequence
MSGNSANYDVGYPIYGAKFINEGTLLVAGGGGQFNSSFPNKITALKVNFQKKKHIRRFRE
ITLDSIDDAPTSLDCNNNLILVGCNELFNDSSMENVNHHLRKFVFEQEHLKFVASIDFNR
TTDPSVFTKFVYINQRATVAAIASSEVPTVIRIIDPRNLTENYEIETGREVNDLHFAPNG
ILLSYITSNSLEVASVRDGNFVARKTDFDKNLVLSNIRFLNDNTLLVAASLSNSDGVSLL
KLGVSSKGVKILKTASFMFDLNGITSMDVSPNKKFVALSSNDNLVAIVSVEKLKLVQLVP
RVHESTITKVTFSPDSRYLASTSMGNTINVLKLSGTSSSILRNIWKFFLNFVLLVVLAGA
IQLGYKHNVHGFIYKHAHDIYKSKFKENTTIDQGSSSYFTINDDYRGITESADIISATDV
ASDIETEFSSFDTSTMRTTTEDEQKFVWISSSADSQFTSADIPTSASSSSSSSSSSFYEE
SVTNEPIVSSPTSEITKPLASPTEPNIVEKPSLPLNSESIDLLSSSSNSITEYPEPTPDL
EEKLSSLIVEQSESEITTDRESVSKLLSTESPSLSHMPSSSSSSLSLSSSLTTSPTTALS
TSTATAVTTTQTNPTNDAANTSFLDNSKPASTREIYKTKIITEVITKIEYRNIPASDSNA
EAEQYVTTSSSMLLTPTDTMVSSPVSEIDPIASELERMVETPTHSISIASEFDSVASNLI
PNEEILSTSASQDSISSHPSTFSDSSITSGFQSIEVSTVTSSVLASESIPSISDSTFSKF
HSISEPVSSAIVETATSSFSKTETKTSRVIAFSTEDSERSSALIDNSEYTSVLADNLEPT
SVLADNSEPTSVLADSSEPTSVFTDAVQSPKTSVGQSSLSESTNIEGTSMASMIFSSSGA
SIGALSDIGKGTLSVESASSTVAQPMPGVTTTAPSFVSSPHKISASSIDASGFVQKEIMI
EVQSSKDSSEAFGVRHKISENVNTPVSRMLTTEMQASGTVDVTEDVSLSSEVISALNVEI
TSLPNPVAPPQTIAAPLNNNSNTNIVNDDNAVAGTVNYAGLHDEL
Download sequence
Identical sequences P25365
YCR067C 4932.YCR067C YCR067C YCR067C YCR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]