SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCR067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR067C
Domain Number 1 Region: 11-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-23
Family Cell cycle arrest protein BUB3 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.692 28.82
regulation of morphogenesis of an epithelium 1.94 28.82
kidney development 1.51 24.61
renal tubule development 2.068 24.61
rRNA metabolic process 2.134 24.37
cilium assembly 1.427 22.48
digestive tract development 2.035 22.18
RNA processing 1.497 18.33
chromosome organization 1.49 16.62
microtubule-based movement 2.011 16.19

Protein sequence

External link(s) Locus: YCR067C   Protein: S000000663
Sequence length 1065
Comment SED4 SGDID:S000000663, Chr III from 236318-233121, reverse complement, Verified ORF, "Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p"
Sequence
MSGNSANYDVGYPIYGAKFINEGTLLVAGGGGQFNSSFPNKITALKVNFQKKKHIRRFRE
ITLDSIDDAPTSLDCNNNLILVGCNELFNDSSMENVNHHLRKFVFEQEHLKFVASIDFNR
TTDPSVFTKFVYINQRATVAAIASSEVPTVIRIIDPRNLTENYEIETGREVNDLHFAPNG
ILLSYITSNSLEVASVRDGNFVARKTDFDKNLVLSNIRFLNDNTLLVAASLSNSDGVSLL
KLGVSSKGVKILKTASFMFDLNGITSMDVSPNKKFVALSSNDNLVAIVSVEKLKLVQLVP
RVHESTITKVTFSPDSRYLASTSMGNTINVLKLSGTSSSILRNIWKFFLNFVLLVVLAGA
IQLGYKHNVHGFIYKHAHDIYKSKFKENTTIDQGSSSYFTINDDYRGITESADIISATDV
ASDIETEFSSFDTSTMRTTTEDEQKFVWISSSADSQFTSADIPTSASSSSSSSSSSFYEE
SVTNEPIVSSPTSEITKPLASPTEPNIVEKPSLPLNSESIDLLSSSSNSITEYPEPTPDL
EEKLSSLIVEQSESEITTDRESVSKLLSTESPSLSHMPSSSSSSLSLSSSLTTSPTTALS
TSTATAVTTTQTNPTNDAANTSFLDNSKPASTREIYKTKIITEVITKIEYRNIPASDSNA
EAEQYVTTSSSMLLTPTDTMVSSPVSEIDPIASELERMVETPTHSISIASEFDSVASNLI
PNEEILSTSASQDSISSHPSTFSDSSITSGFQSIEVSTVTSSVLASESIPSISDSTFSKF
HSISEPVSSAIVETATSSFSKTETKTSRVIAFSTEDSERSSALIDNSEYTSVLADNLEPT
SVLADNSEPTSVLADSSEPTSVFTDAVQSPKTSVGQSSLSESTNIEGTSMASMIFSSSGA
SIGALSDIGKGTLSVESASSTVAQPMPGVTTTAPSFVSSPHKISASSIDASGFVQKEIMI
EVQSSKDSSEAFGVRHKISENVNTPVSRMLTTEMQASGTVDVTEDVSLSSEVISALNVEI
TSLPNPVAPPQTIAAPLNNNSNTNIVNDDNAVAGTVNYAGLHDEL
Download sequence
Identical sequences P25365
YCR067C YCR067C YCR067C 4932.YCR067C YCR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]