SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR067C
Domain Number 1 Region: 11-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-23
Family Cell cycle arrest protein BUB3 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.51
nucleolus 1.652 36.88
methyltransferase complex 2.218 18.65
cilium 1.611 16.73
vacuole 1.428 11.94
nucleoplasm part 1.418 11.42
transcription factor complex 1.882 11.42
cytoplasmic vesicle part 1.738 10.37
cytoplasmic vesicle membrane 1.923 10.37
SWI/SNF superfamily-type complex 2.178 9.97

Protein sequence

External link(s) Locus: YCR067C   Protein: S000000663
Sequence length 1065
Comment SED4 SGDID:S000000663, Chr III from 236318-233121, reverse complement, Verified ORF, "Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p"
Sequence
MSGNSANYDVGYPIYGAKFINEGTLLVAGGGGQFNSSFPNKITALKVNFQKKKHIRRFRE
ITLDSIDDAPTSLDCNNNLILVGCNELFNDSSMENVNHHLRKFVFEQEHLKFVASIDFNR
TTDPSVFTKFVYINQRATVAAIASSEVPTVIRIIDPRNLTENYEIETGREVNDLHFAPNG
ILLSYITSNSLEVASVRDGNFVARKTDFDKNLVLSNIRFLNDNTLLVAASLSNSDGVSLL
KLGVSSKGVKILKTASFMFDLNGITSMDVSPNKKFVALSSNDNLVAIVSVEKLKLVQLVP
RVHESTITKVTFSPDSRYLASTSMGNTINVLKLSGTSSSILRNIWKFFLNFVLLVVLAGA
IQLGYKHNVHGFIYKHAHDIYKSKFKENTTIDQGSSSYFTINDDYRGITESADIISATDV
ASDIETEFSSFDTSTMRTTTEDEQKFVWISSSADSQFTSADIPTSASSSSSSSSSSFYEE
SVTNEPIVSSPTSEITKPLASPTEPNIVEKPSLPLNSESIDLLSSSSNSITEYPEPTPDL
EEKLSSLIVEQSESEITTDRESVSKLLSTESPSLSHMPSSSSSSLSLSSSLTTSPTTALS
TSTATAVTTTQTNPTNDAANTSFLDNSKPASTREIYKTKIITEVITKIEYRNIPASDSNA
EAEQYVTTSSSMLLTPTDTMVSSPVSEIDPIASELERMVETPTHSISIASEFDSVASNLI
PNEEILSTSASQDSISSHPSTFSDSSITSGFQSIEVSTVTSSVLASESIPSISDSTFSKF
HSISEPVSSAIVETATSSFSKTETKTSRVIAFSTEDSERSSALIDNSEYTSVLADNLEPT
SVLADNSEPTSVLADSSEPTSVFTDAVQSPKTSVGQSSLSESTNIEGTSMASMIFSSSGA
SIGALSDIGKGTLSVESASSTVAQPMPGVTTTAPSFVSSPHKISASSIDASGFVQKEIMI
EVQSSKDSSEAFGVRHKISENVNTPVSRMLTTEMQASGTVDVTEDVSLSSEVISALNVEI
TSLPNPVAPPQTIAAPLNNNSNTNIVNDDNAVAGTVNYAGLHDEL
Download sequence
Identical sequences P25365
YCR067C YCR067C 4932.YCR067C YCR067C YCR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]