SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR067C
Domain Number 1 Region: 11-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.37e-23
Family Cell cycle arrest protein BUB3 0.056
Further Details:      
 

Protein sequence

External link(s) Locus: YCR067C   Protein: S000000663
Sequence length 1065
Comment SED4 SGDID:S000000663, Chr III from 236318-233121, reverse complement, Verified ORF, "Integral endoplasmic reticulum membrane protein, functions as a positive regulator of Sar1p probably through inhibition of GTPase activation by Sec23p; binds Sec16p, participates in vesicle formation, similar to Sec12p"
Sequence
MSGNSANYDVGYPIYGAKFINEGTLLVAGGGGQFNSSFPNKITALKVNFQKKKHIRRFRE
ITLDSIDDAPTSLDCNNNLILVGCNELFNDSSMENVNHHLRKFVFEQEHLKFVASIDFNR
TTDPSVFTKFVYINQRATVAAIASSEVPTVIRIIDPRNLTENYEIETGREVNDLHFAPNG
ILLSYITSNSLEVASVRDGNFVARKTDFDKNLVLSNIRFLNDNTLLVAASLSNSDGVSLL
KLGVSSKGVKILKTASFMFDLNGITSMDVSPNKKFVALSSNDNLVAIVSVEKLKLVQLVP
RVHESTITKVTFSPDSRYLASTSMGNTINVLKLSGTSSSILRNIWKFFLNFVLLVVLAGA
IQLGYKHNVHGFIYKHAHDIYKSKFKENTTIDQGSSSYFTINDDYRGITESADIISATDV
ASDIETEFSSFDTSTMRTTTEDEQKFVWISSSADSQFTSADIPTSASSSSSSSSSSFYEE
SVTNEPIVSSPTSEITKPLASPTEPNIVEKPSLPLNSESIDLLSSSSNSITEYPEPTPDL
EEKLSSLIVEQSESEITTDRESVSKLLSTESPSLSHMPSSSSSSLSLSSSLTTSPTTALS
TSTATAVTTTQTNPTNDAANTSFLDNSKPASTREIYKTKIITEVITKIEYRNIPASDSNA
EAEQYVTTSSSMLLTPTDTMVSSPVSEIDPIASELERMVETPTHSISIASEFDSVASNLI
PNEEILSTSASQDSISSHPSTFSDSSITSGFQSIEVSTVTSSVLASESIPSISDSTFSKF
HSISEPVSSAIVETATSSFSKTETKTSRVIAFSTEDSERSSALIDNSEYTSVLADNLEPT
SVLADNSEPTSVLADSSEPTSVFTDAVQSPKTSVGQSSLSESTNIEGTSMASMIFSSSGA
SIGALSDIGKGTLSVESASSTVAQPMPGVTTTAPSFVSSPHKISASSIDASGFVQKEIMI
EVQSSKDSSEAFGVRHKISENVNTPVSRMLTTEMQASGTVDVTEDVSLSSEVISALNVEI
TSLPNPVAPPQTIAAPLNNNSNTNIVNDDNAVAGTVNYAGLHDEL
Download sequence
Identical sequences P25365
YCR067C YCR067C 4932.YCR067C YCR067C YCR067C

Jump to [ Top of page · Domain architecture · Domain assignment details ]