SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR084C
Domain Number 1 Region: 284-405,446-708
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.42e-86
Family WD40-repeat 1.56e-12
Further Details:      
 
Weak hits

Sequence:  YCR084C
Domain Number - Region: 26-116,256-293
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.011
Family Porin chaperone SurA, peptide-binding domain 0.058
Further Details:      
 

Protein sequence

External link(s) Locus: YCR084C   Protein: S000000680
Sequence length 713
Comment TUP1 SGDID:S000000680, Chr III from 262449-260308, reverse complement, Verified ORF, "General repressor of transcription, forms complex with Cyc8p, involved in the establishment of repressive chromatin structure through interactions with histones H3 and H4, appears to enhance expression of some genes"
Sequence
MTASVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVY
ELELTHRKMKDAYEEEIKHLKLGLEQRDHQIASLTVQQQRQQQQQQQVQQHLQQQQQQLA
AASASVPVAQQPPATTSATATPAANTTTGSPSAFPVQASRPNLVGSQLPTTTLPVVSSNA
QQQLPQQQLQQQQLQQQQPPPQVSVAPLSNTAINGSPTSKETTTLPSVKAPESTLKETEP
ENNNTSKINDTGSATTATTTTATETEIKPKEEDATPASLHQDHYLVPYNQRANHSKPIPP
FLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLA
TGCNKTTQVYRVSDGSLVARLSDDSAANNHRNSITENNTTTSTDNNTMTTTTTTTITTTA
MTSAAELAKDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMI
LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK
YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV
KLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKK
SGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN
Download sequence
Identical sequences P16649
YCR084C 4932.YCR084C YCR084C YCR084C

Jump to [ Top of page · Domain architecture · Domain assignment details ]