SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR108C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YCR108C   Protein: S000028536
Sequence length 63
Comment YCR108C SGDID:S000028536, Chr III from 316185-315994, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR"
Sequence
MPYSPSLILMGHTHTDATVYTTLKLPYSHTPIHGPFSLNQYQMHPHHYARHLPQRSIPCA
IYP
Download sequence
Identical sequences Q3E819
YCR108C 4932.YCR108C YCR108C YCR108C

Jump to [ Top of page · Domain architecture · Domain assignment details ]