SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YCR108C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YCR108C   Protein: S000028536
Sequence length 63
Comment YCR108C SGDID:S000028536, Chr III from 316185-315994, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR"
Sequence
MPYSPSLILMGHTHTDATVYTTLKLPYSHTPIHGPFSLNQYQMHPHHYARHLPQRSIPCA
IYP
Download sequence
Identical sequences Q3E819
YCR108C 4932.YCR108C YCR108C YCR108C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]