SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL003W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL003W
Domain Number 1 Region: 485-560
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000193
Family Rad21/Rec8-like 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
protein-DNA complex 1.923 57.09
cytoplasmic vesicle part 1.417 32.5
endosome 1.351 32.5
endosome membrane 1.934 32.5
chromosomal part 1.512 14.52
transferase complex 1.369 13.95
nucleoplasm part 1.369 13.95
DNA-directed RNA polymerase II, holoenzyme 2.009 10.79
replication fork 2.213 9.78
cytosol 1.295 7.87

Protein sequence

External link(s) Locus: YDL003W   Protein: S000002161
Sequence length 566
Comment MCD1 SGDID:S000002161, Chr IV from 444681-446381, Verified ORF, "Essential protein required for sister chromatid cohesion in mitosis and meiosis; subunit of the cohesin complex; expression is cell cycle regulated and peaks in S phase"
Sequence
MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAESAKEIAKASGCDDES
GDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKISMLFKTSQKMTSTVNRLNTV
TRVHQLMLEDAVTEREVLVTPGLEFLDDTTIPVGLMAQENSMERKVQGAAPWDTSLEVGR
RFSPDEDFEHNNLSSMNLDFDIEEGPITSKSWEEGTRQSSRNFDTHENYIQDDDFPLDDA
GTIGWDLGITEKNDQNNDDDDNSVEQGRRLGESIMSEEPTDFGFDLDIEKEAPAGNIDTI
TDAMTESQPKQTGTRRNSKLLNTKSIQIDEETENSESIASSNTYKEERSNNLLTPQPTNF
TTKRLWSEITESMSYLPDPILKNFLSYESLKKRKIHNGREGSIEEPELNVSLNLTDDVIS
NAGTNDNSFNELTDNMSDFVPIDAGLNEAPFPEENIIDAKTRNEQTTIQTEKVRPTPGEV
ASKAIVQMAKILRKELSEEKEVIFTDVLKSQANTEPENITKREASRGFFDILSLATEGCI
GLSQTEAFGNIKIDAKPALFERFINA
Download sequence
Identical sequences N1P4F1 Q12158
4932.YDL003W YDL003W YDL003W YDL003W YDL003W 355229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]