SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL003W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL003W
Domain Number 1 Region: 485-560
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.93e-14
Family Rad21/Rec8-like 1.47e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YDL003W   Protein: S000002161
Sequence length 566
Comment MCD1 SGDID:S000002161, Chr IV from 444681-446381, Verified ORF, "Essential protein required for sister chromatid cohesion in mitosis and meiosis; subunit of the cohesin complex; expression is cell cycle regulated and peaks in S phase"
Sequence
MVTENPQRLTVLRLATNKGPLAQIWLASNMSNIPRGSVIQTHIAESAKEIAKASGCDDES
GDNEYITLRTSGELLQGIVRVYSKQATFLLTDIKDTLTKISMLFKTSQKMTSTVNRLNTV
TRVHQLMLEDAVTEREVLVTPGLEFLDDTTIPVGLMAQENSMERKVQGAAPWDTSLEVGR
RFSPDEDFEHNNLSSMNLDFDIEEGPITSKSWEEGTRQSSRNFDTHENYIQDDDFPLDDA
GTIGWDLGITEKNDQNNDDDDNSVEQGRRLGESIMSEEPTDFGFDLDIEKEAPAGNIDTI
TDAMTESQPKQTGTRRNSKLLNTKSIQIDEETENSESIASSNTYKEERSNNLLTPQPTNF
TTKRLWSEITESMSYLPDPILKNFLSYESLKKRKIHNGREGSIEEPELNVSLNLTDDVIS
NAGTNDNSFNELTDNMSDFVPIDAGLNEAPFPEENIIDAKTRNEQTTIQTEKVRPTPGEV
ASKAIVQMAKILRKELSEEKEVIFTDVLKSQANTEPENITKREASRGFFDILSLATEGCI
GLSQTEAFGNIKIDAKPALFERFINA
Download sequence
Identical sequences Q12158
YDL003W YDL003W 4932.YDL003W YDL003W 355229 YDL003W

Jump to [ Top of page · Domain architecture · Domain assignment details ]