SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL006W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL006W
Domain Number 1 Region: 15-281
Classification Level Classification E-value
Superfamily PP2C-like 9.16e-74
Family PP2C-like 0.00000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
phosphoprotein phosphatase activity 2.036 112.26
phosphoric ester hydrolase activity 1.596 69.36
SMAD binding 2.193 9.63
lyase activity 1.474 8.3
enzyme activator activity 1.376 3.52
kinase activator activity 1.958 3.52

Protein sequence

External link(s) Locus: YDL006W   Protein: S000002164
Sequence length 281
Comment PTC1 SGDID:S000002164, Chr IV from 439907-440752, Verified ORF, "Type 2C protein phosphatase (PP2C); inactivates the osmosensing MAPK cascade by dephosphorylating Hog1p; mutation delays mitochondrial inheritance; deletion reveals defects in precursor tRNA splicing, sporulation and cell separation"
Sequence
MSNHSEILERPETPYDITYRVGVAENKNSKFRRTMEDVHTYVKNFASRLDWGYFAVFDGH
AGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCV
LRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVE
QAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEITSEDKFLILACDGLWDVID
DQDACELIKDITEPNEAAKVLVRYALENGTTDNVTVMVVFL
Download sequence
Identical sequences A6ZXW0 B3LGR4 C7GXZ6 C8Z4R4 E7KAN4 E7KL52 E7NGM1 G2WCE8 H0GDW6 N1PAB2 P35182 W7Q646
YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W SCRT_00513 YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W YDL006W tr|A6ZXW0|A6ZXW0_YEAS7 YDL006W YDL006W YDL006W 4932.YDL006W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]