SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL007C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL007C-A   Protein: S000113557
Sequence length 85
Comment YDL007C-A SGDID:S000113557, Chr IV from 436822-436565, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MFLPIIFHTILTLLNFGKYYCLPIQEDDDKSGKEIEQILDNNIESLGLLLNSMSLSSNFT
TGDPELDSLFQDDLIPELYSVLDGF
Download sequence
Identical sequences A6ZXV8 B3LGR6 C8Z4R2 G2WCE6 N1P5Y7 Q2V2Q0
YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A 4932.YDL007C-A YDL007C-A YDL007C-A SCRT_00515 YDL007C-A tr|A6ZXV8|A6ZXV8_YEAS7 YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]