SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL007C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDL007C-A   Protein: S000113557
Sequence length 85
Comment YDL007C-A SGDID:S000113557, Chr IV from 436822-436565, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MFLPIIFHTILTLLNFGKYYCLPIQEDDDKSGKEIEQILDNNIESLGLLLNSMSLSSNFT
TGDPELDSLFQDDLIPELYSVLDGF
Download sequence
Identical sequences A6ZXV8 B3LGR6 C8Z4R2 G2WCE6 N1P5Y7 Q2V2Q0
YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A 4932.YDL007C-A YDL007C-A YDL007C-A SCRT_00515 YDL007C-A tr|A6ZXV8|A6ZXV8_YEAS7 YDL007C-A YDL007C-A YDL007C-A YDL007C-A YDL007C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]