SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL008W
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily RING/U-box 2.52e-24
Family RING finger domain, C3HC4 0.0022
Further Details:      
 

Protein sequence

External link(s) Locus: YDL008W   Protein: S000002166
Sequence length 165
Comment APC11 SGDID:S000002166, Chr IV from 433495-433992, Verified ORF, "Catalytic core subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition"
Sequence
MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD
QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR
RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR
Download sequence
Identical sequences Q12157
YDL008W 4932.YDL008W YDL008W YDL008W YDL008W YDL008W YDL008W YT6

Jump to [ Top of page · Domain architecture · Domain assignment details ]