SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL008W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL008W
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily RING/U-box 2.52e-24
Family RING finger domain, C3HC4 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 37.02
transferase complex 1.423 24.01
ribonucleoprotein complex 1.414 21.1
integral component of plasma membrane 1.462 14.03
receptor complex 1.511 14.03
cytoplasmic ribonucleoprotein granule 1.98 11.96
microbody 1.95 11.88
condensed chromosome 2.187 10.58
sarcolemma 1.922 9.16
chromosomal part 1.477 7.89

Protein sequence

External link(s) Locus: YDL008W   Protein: S000002166
Sequence length 165
Comment APC11 SGDID:S000002166, Chr IV from 433495-433992, Verified ORF, "Catalytic core subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition"
Sequence
MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD
QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR
RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR
Download sequence
Identical sequences N1P7W6 Q12157
YDL008W YDL008W 4932.YDL008W YDL008W YDL008W YT6 YDL008W YDL008W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]