SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL020C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDL020C
Domain Number - Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000744
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Protein sequence

External link(s) Locus: YDL020C   Protein: S000002178
Sequence length 531
Comment RPN4 SGDID:S000002178, Chr IV from 416706-415111, reverse complement, Verified ORF, "Transcription factor that stimulates expression of proteasome genes; Rpn4p levels are in turn regulated by the 26S proteasome in a negative feedback control mechanism; RPN4 is transcriptionally regulated by various stress responses"
Sequence
MASTELSLKRTLTDILEDELYHTNPGHSQFTSHYQNYHPNASITPYKLVNKNKENNTFTW
NHSLQHQNESSAASIPPQQTYHFPIFNKYADPTLTTTTSFTTSEATANDRQINNVHLIPN
EIKGASETPLQKTVNLKNIMKVSDPYVPTRNTFNYDVKISNDFFDNGDNLYGNDEEVLFY
EDNYNPKMQWSLQDNSAAINNEDARAIFNNEFDSDDDDISDDEEDEIEENCLQQEQHQEE
PLLSLDVTPISMFGSDQKTGRAKSSSHLFNEYSYVDSNMDSISSVVSEDLLDERGHEKIE
DEDEDNDLDEDDIYDISLLKNRRKQSFVLNKNTIDFERFPSPSTSANVPSTATTGKRKPA
KSSSNRSCVSNSNENGTLERIKKPTSAVVSSNASRRKLINYTKKHLSSHSSTNSNSKPST
ASPSAHTSSSDGNNEIFTCQIMNLITNEPCGAQFSRSYDLTRHQNTIHAKRKIVFRCSEC
IKILGSEGYQKTFSRLDALTRHIKSKHEDLSLEQRQEVTKFAKANIGYVMG
Download sequence
Identical sequences N1P5X6 Q03465
YDL020C YDL020C 4932.YDL020C YDL020C GO.34364 YDL020C

Jump to [ Top of page · Domain architecture · Domain assignment details ]