SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL034W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDL034W   Protein: S000002192
Sequence length 114
Comment YDL034W SGDID:S000002192, Chr IV from 391781-392125, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps with verified gene GPR1/YDL035C; YDL034W is not an essential gene"
Sequence
MRSCLKTFRLLSILERKNIPRQPAIRDTADAVIAIILNCNSCGAVNVEVIPGNPSSWLTV
VVLSCRRESTLFSSKDDPFNAFKFGGNPSVIILSWRVCFIRHTSDHLFVVFFFW
Download sequence
Identical sequences Q12448
YDL034W YDL034W 4932.YDL034W YDL034W YDL034W YDL034W YDL034W

Jump to [ Top of page · Domain architecture · Domain assignment details ]