SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL034W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL034W   Protein: S000002192
Sequence length 114
Comment YDL034W SGDID:S000002192, Chr IV from 391781-392125, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps with verified gene GPR1/YDL035C; YDL034W is not an essential gene"
Sequence
MRSCLKTFRLLSILERKNIPRQPAIRDTADAVIAIILNCNSCGAVNVEVIPGNPSSWLTV
VVLSCRRESTLFSSKDDPFNAFKFGGNPSVIILSWRVCFIRHTSDHLFVVFFFW
Download sequence
Identical sequences Q12448
YDL034W YDL034W YDL034W 4932.YDL034W YDL034W YDL034W YDL034W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]