SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL066W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL066W
Domain Number 1 Region: 17-424
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 8.64e-151
Family Dimeric isocitrate & isopropylmalate dehydrogenases 1.29e-10
Further Details:      
 

Protein sequence

External link(s) Locus: YDL066W   Protein: S000002224
Sequence length 428
Comment IDP1 SGDID:S000002224, Chr IV from 334835-336121, Verified ORF, "Mitochondrial NADP-specific isocitrate dehydrogenase, catalyzes the oxidation of isocitrate to alpha-ketoglutarate; not required for mitochondrial respiration and may function to divert alpha-ketoglutarate to biosynthetic processes"
Sequence
MSMLSRRLFSTSRLAAFSKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDL
SVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEARVKEFNLHKMWKSPNGTIRNILG
GTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSDPTTA
QPQTLKVYDYKGSGVAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRF
KDIFQEVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQ
GFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKYQKGEETSTNSIASIFAWSRGLLKR
GELDNTPALCKFANILESATLNTVQQDGIMTKDLALACGNNERSAYVTTEEFLDAVEKRL
QKEIKSIE
Download sequence
Identical sequences A6ZXR0 B3LGW3 B5VFK1 C7GJP4 C8Z4K3 G2WC95 N1P7R0 P21954
YDL066W YDL066W YDL066W YDL066W YDL066W YDL066W YDL066W YDL066W YDL066W YDL066W YDL066W 4932.YDL066W YDL066W SCRT_00564 YDL066W tr|A6ZXR0|A6ZXR0_YEAS7 YDL066W YDL066W YDL066W YDL066W YDL066W

Jump to [ Top of page · Domain architecture · Domain assignment details ]