SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL071C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDL071C   Protein: S000002229
Sequence length 124
Comment YDL071C SGDID:S000002229, Chr IV from 331041-330667, reverse complement, Dubious ORF, "Hypothetical protein"
Sequence
MLVRDIAAEVYFAQSVCFSFSAFSLFRSFLATAPALYIKSLPNNKVAETSANVDHFATVS
LCTSNEKLALVAPHELLEPLPNIIAHLFESFSAALLLKVCVLSKCSCSCSPSMRKHLRVS
PFLF
Download sequence
Identical sequences B5VFJ7 C8Z4J8 E7KAH9 E7LS61 E7Q1W2 E7QCJ6 H0GDS1 Q07438
YDL071C YDL071C 4932.YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C YDL071C

Jump to [ Top of page · Domain architecture · Domain assignment details ]