SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDL075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL075W
Domain Number 1 Region: 6-88
Classification Level Classification E-value
Superfamily Ribosomal protein L31e 3.27e-31
Family Ribosomal protein L31e 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
translation 1.521 21.6
Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.982 30.76
Cellular Component IC (bits) H-Score
ribosomal subunit 2.011 17.52
ribonucleoprotein complex 1.418 11.24
cytosol 1.307 11.06
cytosolic ribosome 2.218 3.95

Protein sequence

External link(s) Locus: YDL075W   Protein: S000002233
Sequence length 113
Comment RPL31A SGDID:S000002233, Chr IV from 322226-322282,322704-322988, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Bp and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p"
Sequence
MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIW
KRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA
Download sequence
Identical sequences A6ZXQ3 B3LGX0 C8Z4J5 G2WC88 N1P462 P0C2H8 W7PVW4
YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W SCRT_00571 YDL075W YDL075W YDL075W YDL075W YDL075W 4932.YDL075W 1vw8.e 1vwu.e 1vxv.e 1vxy.e 2ww9.M 2wwa.M 2wwb.M 3izc.g 3izs.g 3j65.c 3o58.a 3o5h.a 3u5e.d 3u5i.d 4b6a.d 4cuw.d YDL075W tr|A6ZXQ3|A6ZXQ3_YEAS7 YDL075W YDL075W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]