SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL075W
Domain Number 1 Region: 6-88
Classification Level Classification E-value
Superfamily Ribosomal protein L31e 3.27e-31
Family Ribosomal protein L31e 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytosolic ribosome 2.192 37.24
ribosomal subunit 1.939 17.39
cytosolic part 1.704 14.4
intracellular ribonucleoprotein complex 1.329 10.73
Biological Process IC (bits) H-Score
translation 1.507 17.37
ribonucleoprotein complex assembly 1.923 13.25
ribosome biogenesis 1.84 10.52
ribonucleoprotein complex biogenesis 1.694 9.02
Molecular Function IC (bits) H-Score
structural constituent of ribosome 1.946 33.54

Protein sequence

External link(s) Locus: YDL075W   Protein: S000002233
Sequence length 113
Comment RPL31A SGDID:S000002233, Chr IV from 322226-322282,322704-322988, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Bp and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p"
Sequence
MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIW
KRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA
Download sequence
Identical sequences A6ZXQ3 B3LGX0 C8Z4J5 G2WC88 N1P462 P0C2H8 W7PVW4
YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W 4932.YDL075W YDL075W YDL075W tr|A6ZXQ3|A6ZXQ3_YEAS7 YDL075W SCRT_00571 YDL075W YDL075W 1vw8.e 1vwu.e 1vxv.e 1vxy.e 2ww9.M 2wwa.M 2wwb.M 3izc.g 3izs.g 3j65.c 3o58.a 3o5h.a 3u5e.d 3u5i.d 4b6a.d 4cuw.d YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]