SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL075W
Domain Number 1 Region: 6-88
Classification Level Classification E-value
Superfamily Ribosomal protein L31e 3.27e-31
Family Ribosomal protein L31e 0.0022
Further Details:      
 

Protein sequence

External link(s) Locus: YDL075W   Protein: S000002233
Sequence length 113
Comment RPL31A SGDID:S000002233, Chr IV from 322226-322282,322704-322988, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Bp and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p"
Sequence
MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIW
KRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA
Download sequence
Identical sequences A6ZXQ3 B3LGX0 C8Z4J5 G2WC88 N1P462 P0C2H8 W7PVW4
YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W 4932.YDL075W YDL075W SCRT_00571 YDL075W YDL075W tr|A6ZXQ3|A6ZXQ3_YEAS7 YDL075W 2ww9.M 2wwa.M 2wwb.M 3izc.g 3izs.g 3o58.a 3o5h.a 3u5e.d 3u5i.d 4b6a.d YDL075W YDL075W YDL075W YDL075W YDL075W YDL075W

Jump to [ Top of page · Domain architecture · Domain assignment details ]