SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDL086C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL086C-A   Protein: S000028611
Sequence length 144
Comment YDL086C-A SGDID:S000028611, Chr IV from 302089-301655, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps uncharacterized ORF YDL086W; identified by gene-trapping, microarray expression analysis, and genome-wide homology searching"
Sequence
MNACWAARISKNVNFTPWSLRVFLIRSRPCGSTWVSAVPKIKTISWLLPNSFETRSKELS
FWPRPKVLEWMSVGKKQVAQVTLLSRSALKAKWPPKHIPVEPILLPSNWGNWKSRSQHSL
LSSSYDSNGFLILYSLPISVPCTS
Download sequence
Identical sequences Q8TGP8
YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A 4932.YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]