SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL086C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDL086C-A   Protein: S000028611
Sequence length 144
Comment YDL086C-A SGDID:S000028611, Chr IV from 302089-301655, reverse complement, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps uncharacterized ORF YDL086W; identified by gene-trapping, microarray expression analysis, and genome-wide homology searching"
Sequence
MNACWAARISKNVNFTPWSLRVFLIRSRPCGSTWVSAVPKIKTISWLLPNSFETRSKELS
FWPRPKVLEWMSVGKKQVAQVTLLSRSALKAKWPPKHIPVEPILLPSNWGNWKSRSQHSL
LSSSYDSNGFLILYSLPISVPCTS
Download sequence
Identical sequences Q8TGP8
YDL086C-A 4932.YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A YDL086C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]