SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL088C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL088C
Domain Number 1 Region: 270-296,347-391
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.69e-11
Family Canonical RBD 0.012
Further Details:      
 

Protein sequence

External link(s) Locus: YDL088C   Protein: S000002246
Sequence length 528
Comment ASM4 SGDID:S000002246, Chr IV from 300003-298417, reverse complement, Verified ORF, "Nuclear pore complex subunit, part of a subcomplex also containing Nup53p, Nup170p, and Pse1p"
Sequence
MFGIRSGNNNGGFTNLTSQAPQTTQMFQSQSQLQPQPQPQPQQQQQHLQFNGSSDASSLR
FGNSLSNTVNANNYSSNIGNNSINNNNIKNGTNNISQHGQGNNPSWVNNPKKRFTPHTVI
RRKTTKQNSSSDINQNDDSSSMNATMRNFSKQNQDSKHNERNKSAANNDINSLLSNFNDI
PPSVTLQDWQREDEFGSIPSLTTQFVTDKYTAKKTNRSAYDSKNTPNVFDKDSYVRIANI
EQNHLDNNYNTAETNNKVHETSSKSSSLSAIIVFGYPESISNELIEHFSHFGHIMEDFQV
LRLGRGINPNTFRIFHNHDTGCDENDSTVNKSITLKGRNNESNNKKYPIFTGESWVKLTY
NSPSSALRALQENGTIFRGSLIGCIPYSKNAVEQLAGCKIDNVDDIGEFNVSMYQNSSTS
STSNTPSPPNVIITDGTLLREDDNTPAGHAGNPTNISSPIVANSPNKRLDVIDGKLPFMQ
NAGPNSNIPNLLRNLESKMRQQEAKYRNNEPAGFTHKLSNWLFGWNDL
Download sequence
Identical sequences Q05166
YDL088C YDL088C YDL088C 4932.YDL088C YDL088C YDL088C

Jump to [ Top of page · Domain architecture · Domain assignment details ]