SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL088C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL088C
Domain Number 1 Region: 270-296,347-391
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000369
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spliceosomal complex 2.032 51.53
ribonucleoprotein complex 1.414 46.22
nucleoplasm part 1.496 27.05
nuclear body 1.907 27.05
nucleolus 1.641 23.59
cytoplasmic ribonucleoprotein granule 1.98 22.75
small nuclear ribonucleoprotein complex 2.005 9.37
chromosomal part 1.477 7.67
nuclear chromosome 1.73 7.67
chromatin 1.822 7.67

Protein sequence

External link(s) Locus: YDL088C   Protein: S000002246
Sequence length 528
Comment ASM4 SGDID:S000002246, Chr IV from 300003-298417, reverse complement, Verified ORF, "Nuclear pore complex subunit, part of a subcomplex also containing Nup53p, Nup170p, and Pse1p"
Sequence
MFGIRSGNNNGGFTNLTSQAPQTTQMFQSQSQLQPQPQPQPQQQQQHLQFNGSSDASSLR
FGNSLSNTVNANNYSSNIGNNSINNNNIKNGTNNISQHGQGNNPSWVNNPKKRFTPHTVI
RRKTTKQNSSSDINQNDDSSSMNATMRNFSKQNQDSKHNERNKSAANNDINSLLSNFNDI
PPSVTLQDWQREDEFGSIPSLTTQFVTDKYTAKKTNRSAYDSKNTPNVFDKDSYVRIANI
EQNHLDNNYNTAETNNKVHETSSKSSSLSAIIVFGYPESISNELIEHFSHFGHIMEDFQV
LRLGRGINPNTFRIFHNHDTGCDENDSTVNKSITLKGRNNESNNKKYPIFTGESWVKLTY
NSPSSALRALQENGTIFRGSLIGCIPYSKNAVEQLAGCKIDNVDDIGEFNVSMYQNSSTS
STSNTPSPPNVIITDGTLLREDDNTPAGHAGNPTNISSPIVANSPNKRLDVIDGKLPFMQ
NAGPNSNIPNLLRNLESKMRQQEAKYRNNEPAGFTHKLSNWLFGWNDL
Download sequence
Identical sequences Q05166
YDL088C 4932.YDL088C YDL088C YDL088C YDL088C YDL088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]