SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL088C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL088C
Domain Number 1 Region: 270-296,347-391
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000369
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spliceosomal complex 1.914 52.25
intracellular ribonucleoprotein complex 1.329 45.33
nuclear body 1.661 28.48
cytoplasmic ribonucleoprotein granule 1.891 21.3
cytoplasmic region 1.531 10.38
postsynapse 1.593 10.05
neuromuscular junction 1.927 10.05
chromosomal part 1.456 7.8
nuclear chromosome part 1.803 7.8
chromatin 1.848 7.8

Protein sequence

External link(s) Locus: YDL088C   Protein: S000002246
Sequence length 528
Comment ASM4 SGDID:S000002246, Chr IV from 300003-298417, reverse complement, Verified ORF, "Nuclear pore complex subunit, part of a subcomplex also containing Nup53p, Nup170p, and Pse1p"
Sequence
MFGIRSGNNNGGFTNLTSQAPQTTQMFQSQSQLQPQPQPQPQQQQQHLQFNGSSDASSLR
FGNSLSNTVNANNYSSNIGNNSINNNNIKNGTNNISQHGQGNNPSWVNNPKKRFTPHTVI
RRKTTKQNSSSDINQNDDSSSMNATMRNFSKQNQDSKHNERNKSAANNDINSLLSNFNDI
PPSVTLQDWQREDEFGSIPSLTTQFVTDKYTAKKTNRSAYDSKNTPNVFDKDSYVRIANI
EQNHLDNNYNTAETNNKVHETSSKSSSLSAIIVFGYPESISNELIEHFSHFGHIMEDFQV
LRLGRGINPNTFRIFHNHDTGCDENDSTVNKSITLKGRNNESNNKKYPIFTGESWVKLTY
NSPSSALRALQENGTIFRGSLIGCIPYSKNAVEQLAGCKIDNVDDIGEFNVSMYQNSSTS
STSNTPSPPNVIITDGTLLREDDNTPAGHAGNPTNISSPIVANSPNKRLDVIDGKLPFMQ
NAGPNSNIPNLLRNLESKMRQQEAKYRNNEPAGFTHKLSNWLFGWNDL
Download sequence
Identical sequences Q05166
YDL088C YDL088C YDL088C YDL088C 4932.YDL088C YDL088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]