SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDL094C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL094C   Protein: S000002252
Sequence length 169
Comment YDL094C SGDID:S000002252, Chr IV from 290081-289572, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps verfied gene PMT5/YDL093W; YDL094C is not essential"
Sequence
MAVNISKQPTRSFSLDEVTVRNELKLSQGFVMRKDLKGPRLIVTSGMGSTFSKCSLFIFK
AVMILHTCLIVKSIRIFSKKKKRNGSMHNMYYASVPFLLFSNAYSIDFSRHVNEFLEKKR
CEMIIPLKLLADHTYLSEIEYVSLNADGQYSQLQDIFFIHDVFFVYFRF
Download sequence
Identical sequences Q07509
4932.YDL094C YDL094C YDL094C YDL094C YDL094C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]