SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL094C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDL094C   Protein: S000002252
Sequence length 169
Comment YDL094C SGDID:S000002252, Chr IV from 290081-289572, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps verfied gene PMT5/YDL093W; YDL094C is not essential"
Sequence
MAVNISKQPTRSFSLDEVTVRNELKLSQGFVMRKDLKGPRLIVTSGMGSTFSKCSLFIFK
AVMILHTCLIVKSIRIFSKKKKRNGSMHNMYYASVPFLLFSNAYSIDFSRHVNEFLEKKR
CEMIIPLKLLADHTYLSEIEYVSLNADGQYSQLQDIFFIHDVFFVYFRF
Download sequence
Identical sequences Q07509
YDL094C YDL094C 4932.YDL094C YDL094C YDL094C

Jump to [ Top of page · Domain architecture · Domain assignment details ]