SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDL095W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL095W
Domain Number 1 Region: 326-512
Classification Level Classification E-value
Superfamily MIR domain 3.14e-59
Family MIR domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
sarcoplasmic reticulum 1.985 86.89
nuclear outer membrane-endoplasmic reticulum membrane network 1.554 42.53
endoplasmic reticulum part 1.429 38.52
I band 1.436 18.24
postsynaptic density 1.817 11.64
organelle inner membrane 1.672 10.36
nuclear membrane 2.228 6.73
cation channel complex 2.038 6.52
sarcolemma 1.911 6.12
synapse part 1.512 5.09

Protein sequence

External link(s) Locus: YDL095W   Protein: S000002253
Sequence length 817
Comment PMT1 SGDID:S000002253, Chr IV from 287059-289512, Verified ORF, "Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine/threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals"
Sequence
MSEEKTYKRVEQDDPVPELDIKQGPVRPFIVTDPSAELASLRTMVTLKEKLLVACLAVFT
AVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVASLGGFQGDFD
FENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYV
TISRYILLDAPLMFFIAAAVYSFKKYEMYPANSLNAYKSLLATGIALGMASSSKWVGLFT
VTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLDG
DGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQ
STLYPHMDANNDWLLELYNAPGESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSES
SDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLF
SHEVKLPAWGFEQQEVTCASSGRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIES
HKKMWHINKNLVEPHVYESQPTSWPFLLRGISYWGENNRNVYLLGNAIVWWAVTAFIGIF
GLIVITELFSWQLGKPILKDSKVVNFHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAY
YFGILALGHALDIIVSYVFRSKRQMGYAVVITFLAASVYFFKSFSPIIYGTPWTQELCQK
SQWLSGWDYNCNTYFSSLEEYKNQTLTKRESQPAATSTVEEITIEGDGPSYEDLMNEDGK
KIFKDTEGNELDPEVVKKMLEEEGANILKVEKRAVLE
Download sequence
Identical sequences P33775
YDL095W YDL095W YDL095W YDL095W 4932.YDL095W YDL095W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]