SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL095W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL095W
Domain Number 1 Region: 326-512
Classification Level Classification E-value
Superfamily MIR domain 3.14e-59
Family MIR domain 0.00056
Further Details:      
 

Protein sequence

External link(s) Locus: YDL095W   Protein: S000002253
Sequence length 817
Comment PMT1 SGDID:S000002253, Chr IV from 287059-289512, Verified ORF, "Protein O-mannosyltransferase, transfers mannose residues from dolichyl phosphate-D-mannose to protein serine/threonine residues; acts in a complex with Pmt2p, can instead interact with Pmt3p in some conditions; target for new antifungals"
Sequence
MSEEKTYKRVEQDDPVPELDIKQGPVRPFIVTDPSAELASLRTMVTLKEKLLVACLAVFT
AVIRLHGLAWPDSVVFDEVHFGGFASQYIRGTYFMDVHPPLAKMLYAGVASLGGFQGDFD
FENIGDSFPSTTPYVLMRFFSASLGALTVILMYMTLRYSGVRMWVALMSAICFAVENSYV
TISRYILLDAPLMFFIAAAVYSFKKYEMYPANSLNAYKSLLATGIALGMASSSKWVGLFT
VTWVGLLCIWRLWFMIGDLTKSSKSIFKVAFAKLAFLLGVPFALYLVFFYIHFQSLTLDG
DGASFFSPEFRSTLKNNKIPQNVVADVGIGSIISLRHLSTMGGYLHSHSHNYPAGSEQQQ
STLYPHMDANNDWLLELYNAPGESLTTFQNLTDGTKVRLFHTVTRCRLHSHDHKPPVSES
SDWQKEVSCYGYSGFDGDANDDWVVEIDKKNSAPGVAQERVIALDTKFRLRHAMTGCYLF
SHEVKLPAWGFEQQEVTCASSGRHDLTLWYVENNSNPLLPEDTKRISYKPASFISKFIES
HKKMWHINKNLVEPHVYESQPTSWPFLLRGISYWGENNRNVYLLGNAIVWWAVTAFIGIF
GLIVITELFSWQLGKPILKDSKVVNFHVQVIHYLLGFAVHYAPSFLMQRQMFLHHYLPAY
YFGILALGHALDIIVSYVFRSKRQMGYAVVITFLAASVYFFKSFSPIIYGTPWTQELCQK
SQWLSGWDYNCNTYFSSLEEYKNQTLTKRESQPAATSTVEEITIEGDGPSYEDLMNEDGK
KIFKDTEGNELDPEVVKKMLEEEGANILKVEKRAVLE
Download sequence
Identical sequences P33775
YDL095W YDL095W 4932.YDL095W YDL095W YDL095W YDL095W

Jump to [ Top of page · Domain architecture · Domain assignment details ]