SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL111C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL111C
Domain Number 1 Region: 3-160,193-209
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.36e-21
Family Ribonuclease PH domain 1-like 0.0012
Further Details:      
 
Weak hits

Sequence:  YDL111C
Domain Number - Region: 183-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.000903
Family Ribonuclease PH domain 2-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 66.82
nuclear chromosome 1.723 22.12
chromosomal part 1.478 22.12
condensed chromosome 2.187 22.12
ribosomal subunit 2.011 10.33
ribonucleoprotein complex 1.415 9.42
small nuclear ribonucleoprotein complex 2.004 6.93
microbody 1.955 6.65
organellar ribosome 2.149 6.48
chromatin 1.906 6.12

Protein sequence

External link(s) Locus: YDL111C   Protein: S000002269
Sequence length 265
Comment RRP42 SGDID:S000002269, Chr IV from 264110-263313, reverse complement, Verified ORF, "Protein involved in rRNA processing; component of the exosome 3->5 exonuclease complex with Rrp4p, Rrp41p, Rrp43p and Dis3p"
Sequence
MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIV
SIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKY
SFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKL
DINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFK
PHLLKQGLAMVEKYAPDVVRSLENL
Download sequence
Identical sequences G2WC51 N1P5W4 Q12277
YDL111C 4932.YDL111C YDL111C YDL111C YDL111C YDL111C YDL111C 355240 YDL111C YDL111C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]