SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL111C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL111C
Domain Number 1 Region: 3-160,193-209
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.36e-21
Family Ribonuclease PH domain 1-like 0.0012
Further Details:      
 
Weak hits

Sequence:  YDL111C
Domain Number - Region: 183-260
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 0.000903
Family Ribonuclease PH domain 2-like 0.0074
Further Details:      
 

Protein sequence

External link(s) Locus: YDL111C   Protein: S000002269
Sequence length 265
Comment RRP42 SGDID:S000002269, Chr IV from 264110-263313, reverse complement, Verified ORF, "Protein involved in rRNA processing; component of the exosome 3->5 exonuclease complex with Rrp4p, Rrp41p, Rrp43p and Dis3p"
Sequence
MSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIV
SIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKY
SFKIFVDVLVISSHSHPVSLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKL
DINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFK
PHLLKQGLAMVEKYAPDVVRSLENL
Download sequence
Identical sequences G2WC51 Q12277
YDL111C 4932.YDL111C YDL111C YDL111C YDL111C YDL111C YDL111C 355240 YDL111C YDL111C

Jump to [ Top of page · Domain architecture · Domain assignment details ]