SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL131W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL131W
Domain Number 1 Region: 35-312
Classification Level Classification E-value
Superfamily Aldolase 1.48e-69
Family HMGL-like 0.0061
Further Details:      
 

Protein sequence

External link(s) Locus: YDL131W   Protein: S000002289
Sequence length 440
Comment LYS21 SGDID:S000002289, Chr IV from 227393-228715, Verified ORF, "Homocitrate synthase isozyme, catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate, which is the first step in the lysine biosynthesis pathway; highly similar to the other isozyme, Lys20p"
Sequence
MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQFANAFFDTEKK
IEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDARVAVETG
VDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEIRFSSEDSFRSDLVDLL
NIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYT
ALEGGARLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV
EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAI
KSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSIIKDFHAELSTPLLKPVNKGT
DDDNIDISNGHVSKKAKVTK
Download sequence
Identical sequences A6ZXJ7 B3LH22 C8Z6H2 E7KAE8 E7LSC5 E7QCF6 N1P3Z8 Q12122
YDL131W 4932.YDL131W YDL131W YDL131W SCRT_00626 YDL131W YDL131W tr|A6ZXJ7|A6ZXJ7_YEAS7 YDL131W YDL131W YDL131W YDL131W YDL131W YDL131W

Jump to [ Top of page · Domain architecture · Domain assignment details ]