SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL131W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL131W
Domain Number 1 Region: 35-312
Classification Level Classification E-value
Superfamily Aldolase 1.48e-69
Family HMGL-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plastid 1.598 4.22

Protein sequence

External link(s) Locus: YDL131W   Protein: S000002289
Sequence length 440
Comment LYS21 SGDID:S000002289, Chr IV from 227393-228715, Verified ORF, "Homocitrate synthase isozyme, catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate, which is the first step in the lysine biosynthesis pathway; highly similar to the other isozyme, Lys20p"
Sequence
MSENNEFQSVTESTTAPTTSNPYGPNPADYLSNVKNFQLIDSTLREGEQFANAFFDTEKK
IEIARALDDFGVDYIELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDARVAVETG
VDGVDVVIGTSKFLRQYSHGKDMNYIAKSAVEVIEFVKSKGIEIRFSSEDSFRSDLVDLL
NIYKTVDKIGVNRVGIADTVGCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYT
ALEGGARLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVRSKYKLHKIRDIENLVADAV
EVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAI
KSRVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSIIKDFHAELSTPLLKPVNKGT
DDDNIDISNGHVSKKAKVTK
Download sequence
Identical sequences A6ZXJ7 B3LH22 C8Z6H2 E7KAE8 E7LSC5 E7QCF6 N1P3Z8 Q12122
YDL131W 4932.YDL131W YDL131W YDL131W SCRT_00626 YDL131W YDL131W tr|A6ZXJ7|A6ZXJ7_YEAS7 YDL131W YDL131W YDL131W YDL131W YDL131W YDL131W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]