SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL137W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL137W
Domain Number 1 Region: 14-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-57
Family G proteins 4.49e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) Locus: YDL137W   Protein: S000002296
Sequence length 181
Comment ARF2 SGDID:S000002296, Chr IV from 216529-217074, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf1p"
Sequence
MGLYASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKN
ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAV
WLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQ
S
Download sequence
Identical sequences A6ZXJ0 B3LH28 B5VFD4 C7GKY9 C8Z6G5 E7KAE5 E7KLD3 E7LSC0 E7NGJ9 E7Q1S2 E7QCF1 G2WC24 H0GDD7 J8PQI2 N1P7N1 P19146 W7PJ58
YDL137W 1mr3F YDL137W ORFP:3265 ORFP:2713 YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W 4932.YDL137W YDL137W SCRT_00633 YDL137W YDL137W tr|A6ZXJ0|A6ZXJ0_YEAS7 YDL137W 1mr3.F YDL137W YDL137W YDL137W YDL137W YDL137W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]