SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL137W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL137W
Domain Number 1 Region: 14-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-57
Family G proteins 0.0000000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Locus: YDL137W   Protein: S000002296
Sequence length 181
Comment ARF2 SGDID:S000002296, Chr IV from 216529-217074, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf1p"
Sequence
MGLYASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKN
ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAV
WLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQ
S
Download sequence
Identical sequences A0A0L8VT16 A6ZXJ0 B3LH28 B5VFD4 C7GKY9 C8Z6G5 E7KAE5 E7KLD3 E7LSC0 E7NGJ9 E7Q1S2 E7QCF1 G2WC24 H0GDD7 J8PQI2 N1P7N1 P19146
YDL137W YDL137W 4932.YDL137W YDL137W YDL137W YDL137W cath|current|1mr3F00/5-181 YDL137W YDL137W YDL137W YDL137W YDL137W 1mr3.F YDL137W 1mr3F SCRT_00633 tr|A6ZXJ0|A6ZXJ0_YEAS7 ORFP:3265 YDL137W YDL137W YDL137W YDL137W YDL137W ORFP:2713 YDL137W YDL137W YDL137W YDL137W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]