SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL137W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL137W
Domain Number 1 Region: 14-179
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-57
Family G proteins 0.0000000449
Further Details:      
 

Protein sequence

External link(s) Locus: YDL137W   Protein: S000002296
Sequence length 181
Comment ARF2 SGDID:S000002296, Chr IV from 216529-217074, Verified ORF, "ADP-ribosylation factor, GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; functionally interchangeable with Arf1p"
Sequence
MGLYASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKN
ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAV
WLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQ
S
Download sequence
Identical sequences A6ZXJ0 B3LH28 B5VFD4 C7GKY9 C8Z6G5 E7KAE5 E7KLD3 E7LSC0 E7NGJ9 E7Q1S2 E7QCF1 G2WC24 H0GDD7 J8PQI2 N1P7N1 P19146 W7PJ58
YDL137W 1mr3F YDL137W ORFP:3265 ORFP:2713 YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W YDL137W 4932.YDL137W YDL137W SCRT_00633 YDL137W YDL137W tr|A6ZXJ0|A6ZXJ0_YEAS7 YDL137W 1mr3.F YDL137W YDL137W YDL137W YDL137W YDL137W

Jump to [ Top of page · Domain architecture · Domain assignment details ]