SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL138W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL138W
Domain Number 1 Region: 104-301,332-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.79e-58
Family LacY-like proton/sugar symporter 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
carbohydrate transport 2.21 61.71
nucleobase-containing compound transport 2.03 39.18
ion transport 1.48 35.3
transmembrane transport 1.589 31.84
secretion 1.494 23.86
synaptic vesicle cycle 2.21 17.92
neurotransmitter transport 2.183 17.92
cation homeostasis 1.52 16.07
inorganic ion homeostasis 1.505 16.07
cellular chemical homeostasis 1.503 16.07
Cellular Component IC (bits) H-Score
cytoplasmic vesicle part 1.377 14.65
vacuolar part 1.526 14.09
cell projection membrane 1.808 11.21
clathrin-coated vesicle 1.946 10.05
presynapse 1.715 9.7
transport vesicle 1.738 9.64
secretory vesicle 1.491 8.6
exocytic vesicle 1.966 7.78
lytic vacuole 1.526 7.14
brush border 1.374 6.86

Protein sequence

External link(s) Locus: YDL138W   Protein: S000002297
Sequence length 763
Comment RGT2 SGDID:S000002297, Chr IV from 213352-215643, Verified ORF, "Plasma membrane glucose receptor, highly similar to Snf3p; both Rgt2p and Snf3p serve as transmembrane glucose sensors generating an intracellular signal that induces expression of glucose transporter (HXT) genes"
Sequence
MNDSQNCLRQREENSHLNPGNDFGHHQGAECTINHNNMPHRNAYTESTNDTEAKSIVMCD
DPNAYQISYTNNEPAGDGAIETTSILLSQPLPLRSNVMSVLVGIFVAVGGFLFGYDTGLI
NSITDMPYVKTYIAPNHSYFTTSQIAILVSFLSLGTFFGALIAPYISDSYGRKPTIMFST
AVIFSIGNSLQVASGGLVLLIVGRVISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQW
AITIGLLVSSAVSQGTHSKNGPSSYRIPIGLQYVWSSILAVGMIFLPESPRYYVLKDELN
KAAKSLSFLRGLPIEDPRLLEELVEIKATYDYEASFGPSTLLDCFKTSENRPKQILRIFT
GIAIQAFQQASGINFIFYYGVNFFNNTGVDNSYLVSFISYAVNVAFSIPGMYLVDRIGRR
PVLLAGGVIMAIANLVIAIVGVSEGKTVVASKIMIAFICLFIAAFSATWGGVVWVVSAEL
YPLGVRSKCTAICAAANWLVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVV
YFAVYETRGLTLEEIDELFRKAPNSVISSKWNKKIRKRCLAFPISQQIEMKTNIKNAGKL
DNNNSPIVQDDSHNIIDVDGFLENQIQSNDHMIAADKGSGSLVNIIDTAPLTSTEFKPVE
HPPVNYVDLGNGLGLNTYNRGPPSIISDSTDEFYEENDSSYYNNNTERNGANSVNTYMAQ
LINSSSTTSNDTSFSPSHNSNARTSSNWTSDLASKHSQYTSPQ
Download sequence
Identical sequences N1P960 Q12300
4932.YDL138W YDL138W YDL138W YDL138W YDL138W YDL138W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]