SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL138W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL138W
Domain Number 1 Region: 104-301,332-557
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.79e-58
Family LacY-like proton/sugar symporter 0.036
Further Details:      
 

Protein sequence

External link(s) Locus: YDL138W   Protein: S000002297
Sequence length 763
Comment RGT2 SGDID:S000002297, Chr IV from 213352-215643, Verified ORF, "Plasma membrane glucose receptor, highly similar to Snf3p; both Rgt2p and Snf3p serve as transmembrane glucose sensors generating an intracellular signal that induces expression of glucose transporter (HXT) genes"
Sequence
MNDSQNCLRQREENSHLNPGNDFGHHQGAECTINHNNMPHRNAYTESTNDTEAKSIVMCD
DPNAYQISYTNNEPAGDGAIETTSILLSQPLPLRSNVMSVLVGIFVAVGGFLFGYDTGLI
NSITDMPYVKTYIAPNHSYFTTSQIAILVSFLSLGTFFGALIAPYISDSYGRKPTIMFST
AVIFSIGNSLQVASGGLVLLIVGRVISGIGIGIISAVVPLYQAEAAQKNLRGAIISSYQW
AITIGLLVSSAVSQGTHSKNGPSSYRIPIGLQYVWSSILAVGMIFLPESPRYYVLKDELN
KAAKSLSFLRGLPIEDPRLLEELVEIKATYDYEASFGPSTLLDCFKTSENRPKQILRIFT
GIAIQAFQQASGINFIFYYGVNFFNNTGVDNSYLVSFISYAVNVAFSIPGMYLVDRIGRR
PVLLAGGVIMAIANLVIAIVGVSEGKTVVASKIMIAFICLFIAAFSATWGGVVWVVSAEL
YPLGVRSKCTAICAAANWLVNFTCALITPYIVDVGSHTSSMGPKIFFIWGGLNVVAVIVV
YFAVYETRGLTLEEIDELFRKAPNSVISSKWNKKIRKRCLAFPISQQIEMKTNIKNAGKL
DNNNSPIVQDDSHNIIDVDGFLENQIQSNDHMIAADKGSGSLVNIIDTAPLTSTEFKPVE
HPPVNYVDLGNGLGLNTYNRGPPSIISDSTDEFYEENDSSYYNNNTERNGANSVNTYMAQ
LINSSSTTSNDTSFSPSHNSNARTSSNWTSDLASKHSQYTSPQ
Download sequence
Identical sequences N1P960 Q12300
YDL138W YDL138W YDL138W 4932.YDL138W YDL138W YDL138W

Jump to [ Top of page · Domain architecture · Domain assignment details ]