SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL164C
Domain Number 1 Region: 140-383
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 1.2e-81
Family ATP-dependent DNA ligase DNA-binding domain 0.00000521
Further Details:      
 
Domain Number 2 Region: 386-605
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.18e-54
Family ATP-dependent DNA ligase catalytic domain 0.00000106
Further Details:      
 
Domain Number 3 Region: 606-750
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4e-45
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.182 53.06
replication fork 2.213 37.25
nucleoplasm part 1.369 33.64
chromosomal region 1.996 30.26
protein-DNA complex 1.923 25.92
aminoacyl-tRNA synthetase multienzyme complex 2.213 25.16
nuclear chromosome part 1.842 24
ribosomal subunit 1.983 22.4
chromosomal part 1.512 22.28
intracellular ribonucleoprotein complex 1.368 20.13

Protein sequence

External link(s) Locus: YDL164C   Protein: S000002323
Sequence length 755
Comment CDC9 SGDID:S000002323, Chr IV from 167255-164988, reverse complement, Verified ORF, "DNA ligase found in the nucleus and mitochondria, an essential enzyme that joins Okazaki fragments during DNA replication; also acts in nucleotide excision repair, base excision repair, and recombination"
Sequence
MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK
KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP
QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK
QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG
EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK
FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ
VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ
GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV
PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
Download sequence
Identical sequences A6ZXG6 C7GL12 C8Z6D9 G2WC00 P04819
YDL164C YDL164C YDL164C YDL164C YDL164C 4932.YDL164C 354962 tr|A6ZXG6|A6ZXG6_YEAS7 YDL164C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]