SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL164C
Domain Number 1 Region: 140-383
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 1.2e-81
Family ATP-dependent DNA ligase DNA-binding domain 5.21e-06
Further Details:      
 
Domain Number 2 Region: 386-605
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.18e-54
Family ATP-dependent DNA ligase catalytic domain 1.06e-06
Further Details:      
 
Domain Number 3 Region: 606-750
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4e-45
Family DNA ligase/mRNA capping enzyme postcatalytic domain 6.98e-06
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
nuclease activity 1.721 17.73
nucleic acid binding transcription factor activity 1.655 16.49
structural constituent of ribosome 1.982 16.17
nucleotidyltransferase activity 1.651 12.28
aminoacyl-tRNA ligase activity 1.982 9.14
ATPase activity, coupled 1.557 8.38
purine NTP-dependent helicase activity 2.034 8.38
chromatin binding 1.695 7.75
exonuclease activity 1.982 7.5
DNA-dependent ATPase activity 1.852 7.33
Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.219 55.13
replication fork 2.198 34.31
nucleoplasm part 1.418 33.7
nuclear chromosome 1.724 24.47
chromosomal part 1.477 22.68
ribonucleoprotein complex 1.418 20.06
ribosomal subunit 2.012 19.51
DNA-directed RNA polymerase complex 2.005 12.25
ribonucleoprotein granule 1.999 10.39
cytosol 1.308 7.63
Biological Process IC (bits) H-Score
DNA-dependent DNA replication 1.996 68.7
DNA duplex unwinding 1.979 46.97
double-strand break repair 1.886 44.68
tRNA aminoacylation 2.002 39.07
translation 1.521 35.23
telomere organization 2.104 26.38
RNA processing 1.458 21.38
mRNA metabolic process 1.627 21.38
RNA 3'-end processing 2.027 21.38
regulation of DNA replication 2.144 20.24

Protein sequence

External link(s) Locus: YDL164C   Protein: S000002323
Sequence length 755
Comment CDC9 SGDID:S000002323, Chr IV from 167255-164988, reverse complement, Verified ORF, "DNA ligase found in the nucleus and mitochondria, an essential enzyme that joins Okazaki fragments during DNA replication; also acts in nucleotide excision repair, base excision repair, and recombination"
Sequence
MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK
KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP
QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK
QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG
EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK
FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ
VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ
GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV
PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
Download sequence
Identical sequences A6ZXG6 C7GL12 C8Z6D9 G2WC00 P04819 W7PNF3
YDL164C 4932.YDL164C YDL164C YDL164C YDL164C tr|A6ZXG6|A6ZXG6_YEAS7 YDL164C 354962 YDL164C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]