SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL164C
Domain Number 1 Region: 140-383
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 1.2e-81
Family ATP-dependent DNA ligase DNA-binding domain 0.00000521
Further Details:      
 
Domain Number 2 Region: 386-605
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.18e-54
Family ATP-dependent DNA ligase catalytic domain 0.00000106
Further Details:      
 
Domain Number 3 Region: 606-750
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4e-45
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 55.21
nucleoplasm part 1.419 33.74
replication fork 2.197 33.6
nuclear chromosome 1.723 24.38
chromosomal part 1.478 22.67
ribonucleoprotein complex 1.415 20.38
ribosomal subunit 2.011 19.53
DNA-directed RNA polymerase complex 2.004 12.27
ribonucleoprotein granule 1.998 10.37
cytosol 1.305 7.61
Biological Process IC (bits) H-Score
DNA-dependent DNA replication 2.082 68.79
DNA duplex unwinding 1.979 46.97
double-strand break repair 1.882 44.57
tRNA aminoacylation 2.003 38.45
translation 1.522 35.24
telomere organization 2.104 26.38
RNA processing 1.457 21.41
mRNA metabolic process 1.625 21.41
RNA 3'-end processing 2.028 21.41
regulation of DNA replication 2.144 20.27

Protein sequence

External link(s) Locus: YDL164C   Protein: S000002323
Sequence length 755
Comment CDC9 SGDID:S000002323, Chr IV from 167255-164988, reverse complement, Verified ORF, "DNA ligase found in the nucleus and mitochondria, an essential enzyme that joins Okazaki fragments during DNA replication; also acts in nucleotide excision repair, base excision repair, and recombination"
Sequence
MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK
KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP
QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK
QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG
EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK
FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ
VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ
GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV
PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
Download sequence
Identical sequences A6ZXG6 C7GL12 C8Z6D9 G2WC00 P04819 W7PNF3
YDL164C YDL164C YDL164C YDL164C tr|A6ZXG6|A6ZXG6_YEAS7 354962 YDL164C 4932.YDL164C YDL164C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]