SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL164C
Domain Number 1 Region: 140-383
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 1.2e-81
Family ATP-dependent DNA ligase DNA-binding domain 5.21e-06
Further Details:      
 
Domain Number 2 Region: 386-605
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.18e-54
Family ATP-dependent DNA ligase catalytic domain 1.06e-06
Further Details:      
 
Domain Number 3 Region: 606-750
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4e-45
Family DNA ligase/mRNA capping enzyme postcatalytic domain 6.98e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YDL164C   Protein: S000002323
Sequence length 755
Comment CDC9 SGDID:S000002323, Chr IV from 167255-164988, reverse complement, Verified ORF, "DNA ligase found in the nucleus and mitochondria, an essential enzyme that joins Okazaki fragments during DNA replication; also acts in nucleotide excision repair, base excision repair, and recombination"
Sequence
MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK
KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP
QQSQRLVGEVEDALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMK
QSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDLG
EIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEAK
FLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFCQ
VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY
DGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKDQ
GKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKVV
PGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKD
YLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL
HDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSL
RFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN
Download sequence
Identical sequences A6ZXG6 C7GL12 C8Z6D9 G2WC00 P04819 W7PNF3
YDL164C 4932.YDL164C YDL164C YDL164C YDL164C tr|A6ZXG6|A6ZXG6_YEAS7 YDL164C 354962 YDL164C

Jump to [ Top of page · Domain architecture · Domain assignment details ]