SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL170W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL170W
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 3.4e-09
Family Zn2/Cys6 DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL170W   Protein: S000002329
Sequence length 528
Comment UGA3 SGDID:S000002329, Chr IV from 156319-157905, Verified ORF, "Transcriptional activator necessary for gamma-aminobutyrate (GABA)-dependent induction of GABA genes (such as UGA1, UGA2, UGA4); zinc-finger transcription factor of the Zn(2)-Cys(6) binuclear cluster domain type; localized to the nucleus"
Sequence
MNYGVEKLKLKYSKHGCITCKIRKKRCSEDKPVCRDCRRLSFPCIYISESVDKQSLKKIK
ADIQHQLISKKRKHAPDSAQKAAVATRTRRVGSDEQDNQVYLSKPLEDCISQKLDSMGLQ
LYNYYRSHLANIISIAPMNQNYYLNIFLPMAHENDGILFAILAWSANHLSISSSNELRKD
EIFVNLANKYTYMSLSHLKTNEGSSACAKLGFLYSLAQILILCGSEICQGDVKFWKILLN
IGKNLIENHVGKDVSRILTTTTEEPSLEERIIFPNFNSVVKYWLIVNFIYHDILNFNTTS
FPIEQYEKFFQRDQNSLPSSANFIESIDSPIEEIDPLIGINKPILLLLGQVTNLTRFLQT
MEQEEMLEHGDKILSLQVEIYKLQPSLMALEHLDDEKKFYYLELFEIMKISTLMFFQLTL
LKIDKDSLELQILRNKLDSKLDKVIGTFLEGSLCFPLFIYGVCIQVEDMEKKIDLEAKFD
DILKRYKCYNFQNARLLIRKIWQNEADGISEHDLVHMIDELDYNINFA
Download sequence
Identical sequences N1P923 P26370
YDL170W YDL170W 4932.YDL170W YDL170W YDL170W YDL170W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]