SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL170W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL170W
Domain Number 1 Region: 8-50
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 3.4e-09
Family Zn2/Cys6 DNA-binding domain 0.0028
Further Details:      
 

Protein sequence

External link(s) Locus: YDL170W   Protein: S000002329
Sequence length 528
Comment UGA3 SGDID:S000002329, Chr IV from 156319-157905, Verified ORF, "Transcriptional activator necessary for gamma-aminobutyrate (GABA)-dependent induction of GABA genes (such as UGA1, UGA2, UGA4); zinc-finger transcription factor of the Zn(2)-Cys(6) binuclear cluster domain type; localized to the nucleus"
Sequence
MNYGVEKLKLKYSKHGCITCKIRKKRCSEDKPVCRDCRRLSFPCIYISESVDKQSLKKIK
ADIQHQLISKKRKHAPDSAQKAAVATRTRRVGSDEQDNQVYLSKPLEDCISQKLDSMGLQ
LYNYYRSHLANIISIAPMNQNYYLNIFLPMAHENDGILFAILAWSANHLSISSSNELRKD
EIFVNLANKYTYMSLSHLKTNEGSSACAKLGFLYSLAQILILCGSEICQGDVKFWKILLN
IGKNLIENHVGKDVSRILTTTTEEPSLEERIIFPNFNSVVKYWLIVNFIYHDILNFNTTS
FPIEQYEKFFQRDQNSLPSSANFIESIDSPIEEIDPLIGINKPILLLLGQVTNLTRFLQT
MEQEEMLEHGDKILSLQVEIYKLQPSLMALEHLDDEKKFYYLELFEIMKISTLMFFQLTL
LKIDKDSLELQILRNKLDSKLDKVIGTFLEGSLCFPLFIYGVCIQVEDMEKKIDLEAKFD
DILKRYKCYNFQNARLLIRKIWQNEADGISEHDLVHMIDELDYNINFA
Download sequence
Identical sequences N1P923 P26370
YDL170W YDL170W 4932.YDL170W YDL170W YDL170W YDL170W

Jump to [ Top of page · Domain architecture · Domain assignment details ]