SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL182W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL182W
Domain Number 1 Region: 21-298
Classification Level Classification E-value
Superfamily Aldolase 1.28e-69
Family HMGL-like 0.0063
Further Details:      
 

Protein sequence

External link(s) Locus: YDL182W   Protein: S000002341
Sequence length 428
Comment LYS20 SGDID:S000002341, Chr IV from 133438-134724, Verified ORF, "Homocitrate synthase isozyme, catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate, which is the first step in the lysine biosynthesis pathway; highly similar to the other isozyme, Lys21p"
Sequence
MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIARALDDFGVDY
IELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAKVAVETGVDGVDVVIGTSKFL
RQYSHGKDMNYIAKSAVEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRV
GIADTVGCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVL
GIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC
AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARVDQLNLNLTDD
QIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVLSAKKNKKNDSDVPELATIPA
AKRTKPSA
Download sequence
Identical sequences A6ZXE9 B3LH66 C8Z6C2 E7LS92 N1PAJ0 P48570
YDL182W YDL182W 4932.YDL182W YDL182W YDL182W SCRT_00674 YDL182W tr|A6ZXE9|A6ZXE9_YEAS7 YDL182W YDL182W YDL182W YDL182W YDL182W NYSGXRC-P031 YDL182W

Jump to [ Top of page · Domain architecture · Domain assignment details ]