SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL182W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL182W
Domain Number 1 Region: 21-298
Classification Level Classification E-value
Superfamily Aldolase 1.28e-69
Family HMGL-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plastid 1.6 4.24

Protein sequence

External link(s) Locus: YDL182W   Protein: S000002341
Sequence length 428
Comment LYS20 SGDID:S000002341, Chr IV from 133438-134724, Verified ORF, "Homocitrate synthase isozyme, catalyzes the condensation of acetyl-CoA and alpha-ketoglutarate to form homocitrate, which is the first step in the lysine biosynthesis pathway; highly similar to the other isozyme, Lys21p"
Sequence
MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIARALDDFGVDY
IELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAKVAVETGVDGVDVVIGTSKFL
RQYSHGKDMNYIAKSAVEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRV
GIADTVGCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVL
GIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC
AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARVDQLNLNLTDD
QIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVLSAKKNKKNDSDVPELATIPA
AKRTKPSA
Download sequence
Identical sequences A6ZXE9 B3LH66 C8Z6C2 E7LS92 N1PAJ0 P48570
YDL182W YDL182W NYSGXRC-P031 YDL182W YDL182W YDL182W tr|A6ZXE9|A6ZXE9_YEAS7 YDL182W SCRT_00674 YDL182W YDL182W YDL182W YDL182W 4932.YDL182W YDL182W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]