SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL185C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDL185C-A   Protein: S000007600
Sequence length 75
Comment YDL185C-A SGDID:S000007600, Chr IV from 126836-126609, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YDL185W; identified by homology with hemiascomycetous yeast species"
Sequence
MRFFLFPYERFQLHQPLFLFFSICFLTLRMKERLLRYNLRYLYALRNVFGTFYSNQRSNQ
NVATLSKEPFLVFSF
Download sequence
Identical sequences C8Z6B8 P0C5M4
YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A 4932.YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]