SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL185C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDL185C-A   Protein: S000007600
Sequence length 75
Comment YDL185C-A SGDID:S000007600, Chr IV from 126836-126609, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YDL185W; identified by homology with hemiascomycetous yeast species"
Sequence
MRFFLFPYERFQLHQPLFLFFSICFLTLRMKERLLRYNLRYLYALRNVFGTFYSNQRSNQ
NVATLSKEPFLVFSF
Download sequence
Identical sequences C8Z6B8 P0C5M4
YDL185C-A YDL185C-A YDL185C-A YDL185C-A 4932.YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A YDL185C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]