SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL209C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL209C
Domain Number 1 Region: 123-232
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000312
Family Canonical RBD 0.0072
Further Details:      
 
Weak hits

Sequence:  YDL209C
Domain Number - Region: 69-92
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000135
Family CCCH zinc finger 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spliceosomal complex 2.032 51.53
ribonucleoprotein complex 1.414 46.22
nucleoplasm part 1.496 27.05
nuclear body 1.907 27.05
nucleolus 1.641 23.59
cytoplasmic ribonucleoprotein granule 1.98 22.75
small nuclear ribonucleoprotein complex 2.005 9.37
chromosomal part 1.477 7.67
nuclear chromosome 1.73 7.67
chromatin 1.822 7.67

Protein sequence

External link(s) Locus: YDL209C   Protein: S000002368
Sequence length 339
Comment CWC2 SGDID:S000002368, Chr IV from 87227-86208, reverse complement, Verified ORF, "Protein involved in pre-mRNA splicing, component of a complex containing Cef1p; interacts with Prp19p; contains an RNA recognition motif; has similarity to S. pombe Cwf2p"
Sequence
MTSWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFALQPQLHSG
KTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKLALRTEVLDCFGREKFADY
REDMGGIGSFRKKNKTLYVGGIDGALNSKHLKPAQIESRIRFVFSRLGDIDRIRYVESKN
CGFVKFKYQANAEFAKEAMSNQTLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQE
ELKLESLNMMVHLINNNTNSAGTEVNNKNNERLDRTFPEASVDNVKKRLLPLDNGMESDD
FIEKLKKVKKNISRENISSKPSVGKLGGPLLDYLSSDED
Download sequence
Identical sequences A6ZXC4 C8Z6R0 G2WBV8 H0GS45 N1PAD9 Q12046
YDL209C YDL209C YDL209C tr|A6ZXC4|A6ZXC4_YEAS7 YDL209C YDL209C YDL209C 4932.YDL209C YDL209C YDL209C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]