SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL209C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL209C
Domain Number 1 Region: 123-232
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.12e-10
Family Canonical RBD 0.0072
Further Details:      
 
Weak hits

Sequence:  YDL209C
Domain Number - Region: 69-92
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000135
Family CCCH zinc finger 0.0057
Further Details:      
 

Protein sequence

External link(s) Locus: YDL209C   Protein: S000002368
Sequence length 339
Comment CWC2 SGDID:S000002368, Chr IV from 87227-86208, reverse complement, Verified ORF, "Protein involved in pre-mRNA splicing, component of a complex containing Cef1p; interacts with Prp19p; contains an RNA recognition motif; has similarity to S. pombe Cwf2p"
Sequence
MTSWRDKSAKVQVKESELPSSIPAQTGLTFNIWYNKWSQGFAGNTRFVSPFALQPQLHSG
KTRGDNDGQLFFCLFFAKGMCCLGPKCEYLHHIPDEEDIGKLALRTEVLDCFGREKFADY
REDMGGIGSFRKKNKTLYVGGIDGALNSKHLKPAQIESRIRFVFSRLGDIDRIRYVESKN
CGFVKFKYQANAEFAKEAMSNQTLLLPSDKEWDDRREGTGLLVKWANEDPDPAAQKRLQE
ELKLESLNMMVHLINNNTNSAGTEVNNKNNERLDRTFPEASVDNVKKRLLPLDNGMESDD
FIEKLKKVKKNISRENISSKPSVGKLGGPLLDYLSSDED
Download sequence
Identical sequences A6ZXC4 C8Z6R0 G2WBV8 H0GS45 N1PAD9 Q12046
YDL209C 4932.YDL209C YDL209C YDL209C YDL209C YDL209C tr|A6ZXC4|A6ZXC4_YEAS7 YDL209C YDL209C YDL209C

Jump to [ Top of page · Domain architecture · Domain assignment details ]