SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL215C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL215C
Domain Number 1 Region: 718-815,847-1023
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.53e-47
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 526-728
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 2.97e-27
Family Aminoacid dehydrogenases 0.0051
Further Details:      
 

Protein sequence

External link(s) Locus: YDL215C   Protein: S000002374
Sequence length 1092
Comment GDH2 SGDID:S000002374, Chr IV from 73919-70641, reverse complement, Verified ORF, "NAD(+)-dependent glutamate dehydrogenase, degrades glutamate to ammonia and alpha-ketoglutarate; expression sensitive to nitrogen catabolite repression and intracellular ammonia levels"
Sequence
MLFDNKNRGALNSLNTPDIASLSISSMSDYHVFDFPGKDLQREEVIDLLDQQGFIPDDLI
EQEVDWFYNSLGIDDLFFSRESPQLISNIIHSLYASKLDFFAKSKFNGIQPRLFSIKNKI
ITNDNHAIFMESNTGVSISDSQQKNFKFASDAVGNDTLEHGKDTIKKNRIEMDDSCPPYE
LDSEIDDLFLDNKSQKNCRLVSFWAPESELKLTFVYESVYPNDDPAGVDISSQDLLKGDI
ESISDKTMYKVSSNENKKLYGLLLKLVKEREGPVIKTTRSVENKDEIRLLVAYKRFTTKR
YYSALNSLFHYYKLKPSKFYLESFNVKDDDIIIFSVYLNENQQLEDVLLHDVEAALKQVE
REASLLYAIPNNSFHEVYQRRQFSPKEAIYAHIGAIFINHFVNRLGSDYQNLLSQITIKR
NDTTLLEIVENLKRKLRNETLTQQTIINIMSKHYTIISKLYKNFAQIHYYHNSTKDMEKT
LSFQRLEKVEPFKNDQEFEAYLNKFIPNDSPDLLILKTLNIFNKSILKTNFFITRKVAIS
FRLDPSLVMTKFEYPETPYGIFFVVGNTFKGFHIRFRDIARGGIRIVCSRNQDIYDLNSK
NVIDENYQLASTQQRKNKDIPEGGSKGVILLNPGLVEHDQTFVAFSQYVDAMIDILINDP
LKENYVNLLPKEEILFFGPDEGTAGFVDWATNHARVRNCPWWKSFLTGKSPSLGGIPHDE
YGMTSLGVRAYVNKIYETLNLTNSTVYKFQTGGPDGDLGSNEILLSSPNECYLAILDGSG
VLCDPKGLDKDELCRLAHERKMISDFDTSKLSNNGFFVSVDAMDIMLPNGTIVANGTTFR
NTFHTQIFKFVDHVDIFVPCGGRPNSITLNNLHYFVDEKTGKCKIPYIVEGANLFITQPA
KNALEEHGCILFKDASANKGGVTSSSMEVLASLALNDNDFVHKFIGDVSGERSALYKSYV
VEVQSRIQKNAELEFGQLWNLNQLNGTHISEISNQLSFTINKLNDDLVASQELWLNDLKL
RNYLLLDKIIPKILIDVAGPQSVLENIPESYLKVLLSSYLSSTFVYQNGIDVNIGKFLEF
IGGLKREAEASA
Download sequence
Identical sequences P33327
YDL215C YDL215C 4932.YDL215C YDL215C YDL215C YDL215C

Jump to [ Top of page · Domain architecture · Domain assignment details ]