SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL215C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL215C
Domain Number 1 Region: 718-815,847-1023
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.53e-47
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0039
Further Details:      
 
Domain Number 2 Region: 526-728
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 2.97e-27
Family Aminoacid dehydrogenases 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
integral to plasma membrane 1.469 17.18
cilium 1.61 15.49
cilium part 1.917 15.49
microbody 1.955 12.44
synapse part 1.512 9.56
axon 1.502 9.56
cation channel complex 2.038 7.94
Golgi membrane 1.605 7.27
intrinsic to organelle membrane 2.082 7.27
neuron projection terminus 2.106 6.64

Protein sequence

External link(s) Locus: YDL215C   Protein: S000002374
Sequence length 1092
Comment GDH2 SGDID:S000002374, Chr IV from 73919-70641, reverse complement, Verified ORF, "NAD(+)-dependent glutamate dehydrogenase, degrades glutamate to ammonia and alpha-ketoglutarate; expression sensitive to nitrogen catabolite repression and intracellular ammonia levels"
Sequence
MLFDNKNRGALNSLNTPDIASLSISSMSDYHVFDFPGKDLQREEVIDLLDQQGFIPDDLI
EQEVDWFYNSLGIDDLFFSRESPQLISNIIHSLYASKLDFFAKSKFNGIQPRLFSIKNKI
ITNDNHAIFMESNTGVSISDSQQKNFKFASDAVGNDTLEHGKDTIKKNRIEMDDSCPPYE
LDSEIDDLFLDNKSQKNCRLVSFWAPESELKLTFVYESVYPNDDPAGVDISSQDLLKGDI
ESISDKTMYKVSSNENKKLYGLLLKLVKEREGPVIKTTRSVENKDEIRLLVAYKRFTTKR
YYSALNSLFHYYKLKPSKFYLESFNVKDDDIIIFSVYLNENQQLEDVLLHDVEAALKQVE
REASLLYAIPNNSFHEVYQRRQFSPKEAIYAHIGAIFINHFVNRLGSDYQNLLSQITIKR
NDTTLLEIVENLKRKLRNETLTQQTIINIMSKHYTIISKLYKNFAQIHYYHNSTKDMEKT
LSFQRLEKVEPFKNDQEFEAYLNKFIPNDSPDLLILKTLNIFNKSILKTNFFITRKVAIS
FRLDPSLVMTKFEYPETPYGIFFVVGNTFKGFHIRFRDIARGGIRIVCSRNQDIYDLNSK
NVIDENYQLASTQQRKNKDIPEGGSKGVILLNPGLVEHDQTFVAFSQYVDAMIDILINDP
LKENYVNLLPKEEILFFGPDEGTAGFVDWATNHARVRNCPWWKSFLTGKSPSLGGIPHDE
YGMTSLGVRAYVNKIYETLNLTNSTVYKFQTGGPDGDLGSNEILLSSPNECYLAILDGSG
VLCDPKGLDKDELCRLAHERKMISDFDTSKLSNNGFFVSVDAMDIMLPNGTIVANGTTFR
NTFHTQIFKFVDHVDIFVPCGGRPNSITLNNLHYFVDEKTGKCKIPYIVEGANLFITQPA
KNALEEHGCILFKDASANKGGVTSSSMEVLASLALNDNDFVHKFIGDVSGERSALYKSYV
VEVQSRIQKNAELEFGQLWNLNQLNGTHISEISNQLSFTINKLNDDLVASQELWLNDLKL
RNYLLLDKIIPKILIDVAGPQSVLENIPESYLKVLLSSYLSSTFVYQNGIDVNIGKFLEF
IGGLKREAEASA
Download sequence
Identical sequences N1P679 P33327
YDL215C YDL215C 4932.YDL215C YDL215C YDL215C YDL215C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]