SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDL244W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL244W
Domain Number 1 Region: 5-239
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.96e-33
Family Phosphate binding protein-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
receptor complex 1.51 69.29
synaptic membrane 1.862 55.42
synapse part 1.512 41.09
neuron spine 2.168 38.43
postsynaptic density 1.817 35.86
integral to plasma membrane 1.469 33.33
dendrite 1.547 24.49
secretory granule 1.826 13.02
coated pit 2.131 9.27
external encapsulating structure 1.632 8.47

Protein sequence

External link(s) Locus: YDL244W   Protein: S000002403
Sequence length 340
Comment THI13 SGDID:S000002403, Chr IV from 16204-17226, Verified ORF, "Protein involved in synthesis of the thiamine precursor hydroxymethylpyrimidine (HMP); member of a subtelomeric gene family including THI5, THI11, THI12, and THI13"
Sequence
MSTDKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDIAILEPTNPSDVTELIGSGKVDMG
LKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKI
QIDELTKHYGMKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPAS
DAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWK
EYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNE
YLSWPEPEEVSDPLEAQRLMAIHQEKCRQEGTFKRLALPA
Download sequence
Identical sequences A6ZQB4 B3LHB9 E7KE04 E7QM81 H0GIZ6 Q07748
YDL244W YDL244W YJR156C YNL332W YDL244W YJR156C YFL058W YJR156C YNL332W YDL244W YFL058W YJR156C YDL244W YNL332W 4932.YDL244W YDL244W YDL244W YJR156C YNL332W SCRT_00731 SCRT_03455 YDL244W YJR156C tr|A6ZQB4|A6ZQB4_YEAS7 YFL058W YJR156C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]