SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDR015C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR015C   Protein: S000002422
Sequence length 79
Comment YDR015C SGDID:S000002422, Chr IV from 478197-477958, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene HED1/YDR014W-A"
Sequence
MSCSFHISSPLGSSSSLEGFSSLKVVVVACQALSRDLLGIDLVLLLLFWRPDKHPHWGFR
HLCSQTDFWHEVVVFPIPN
Download sequence
Identical sequences Q12195
YDR015C YDR015C YDR015C YDR015C 4932.YDR015C YDR015C YDR015C YDR015C YDR015C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]