SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR015C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR015C   Protein: S000002422
Sequence length 79
Comment YDR015C SGDID:S000002422, Chr IV from 478197-477958, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene HED1/YDR014W-A"
Sequence
MSCSFHISSPLGSSSSLEGFSSLKVVVVACQALSRDLLGIDLVLLLLFWRPDKHPHWGFR
HLCSQTDFWHEVVVFPIPN
Download sequence
Identical sequences Q12195
YDR015C YDR015C 4932.YDR015C YDR015C YDR015C YDR015C YDR015C YDR015C YDR015C

Jump to [ Top of page · Domain architecture · Domain assignment details ]