SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR023W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR023W
Domain Number 1 Region: 151-435
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.02e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 2.53e-06
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily tRNA-binding arm 5.75e-18
Family Seryl-tRNA synthetase (SerRS) 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YDR023W   Protein: S000002430
Sequence length 462
Comment SES1 SGDID:S000002430, Chr IV from 489506-490894, Verified ORF, "Cytosolic seryl-tRNA synthetase, class II aminoacyl-tRNA synthetase that aminoacylates tRNA(Ser), displays tRNA-dependent amino acid recognition which enhances discrimination of the serine substrate, interacts with peroxin Pex21p"
Sequence
MLDINQFIEDKGGNPELIRQSQKARNASVEIVDEIISDYKDWVKTRFELDELNKKFNKLQ
KDIGLKFKNKEDASGLLAEKEKLTQQKKELTEKEQQEDKDLKKKVFQVGNIVHPSVVVSN
DEENNELVRTWKPEDLEAVGPIASVTGKPASLSHHEILLRLDGYDPDRGVKICGHRGYFF
RNYGVFLNQALINYGLQFLAAKGYIPLQAPVMMNKELMSKTAQLSEFDEELYKVIDGEDE
KYLIATSEQPISAYHSGEWFEKPQEQLPIHYVGYSSCFRREAGSHGKDAWGVFRVHAFEK
IEQFVITEPEKSWEEFEKMISYSEEFYKSLKLPYRIVGIVSGELNNAAAKKYDLEAWFPY
QKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVHCLNSTLAATQRALCCILENYQ
TEDGLVVPEVLRKYIPGEPEFLPFVNELPKNSTSSKDKKKKN
Download sequence
Identical sequences A6ZXY7 B3LGP1 C7GLX3 E7KAL1 E7QCP5 G2WAD0 P07284
YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W 4932.YDR023W YDR023W SCRT_00487 YDR023W tr|A6ZXY7|A6ZXY7_YEAS7 YDR023W YDR023W YDR023W YDR023W

Jump to [ Top of page · Domain architecture · Domain assignment details ]