SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDR023W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR023W
Domain Number 1 Region: 151-435
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.02e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000253
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily tRNA-binding arm 5.75e-18
Family Seryl-tRNA synthetase (SerRS) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plastid 1.598 5.44
ribonucleoprotein complex 1.418 4.89
spliceosomal complex 2.025 4.89

Protein sequence

External link(s) Locus: YDR023W   Protein: S000002430
Sequence length 462
Comment SES1 SGDID:S000002430, Chr IV from 489506-490894, Verified ORF, "Cytosolic seryl-tRNA synthetase, class II aminoacyl-tRNA synthetase that aminoacylates tRNA(Ser), displays tRNA-dependent amino acid recognition which enhances discrimination of the serine substrate, interacts with peroxin Pex21p"
Sequence
MLDINQFIEDKGGNPELIRQSQKARNASVEIVDEIISDYKDWVKTRFELDELNKKFNKLQ
KDIGLKFKNKEDASGLLAEKEKLTQQKKELTEKEQQEDKDLKKKVFQVGNIVHPSVVVSN
DEENNELVRTWKPEDLEAVGPIASVTGKPASLSHHEILLRLDGYDPDRGVKICGHRGYFF
RNYGVFLNQALINYGLQFLAAKGYIPLQAPVMMNKELMSKTAQLSEFDEELYKVIDGEDE
KYLIATSEQPISAYHSGEWFEKPQEQLPIHYVGYSSCFRREAGSHGKDAWGVFRVHAFEK
IEQFVITEPEKSWEEFEKMISYSEEFYKSLKLPYRIVGIVSGELNNAAAKKYDLEAWFPY
QKEYKELVSCSNCTDYQSRNLEIRCGIKKMGDREKKYVHCLNSTLAATQRALCCILENYQ
TEDGLVVPEVLRKYIPGEPEFLPFVNELPKNSTSSKDKKKKN
Download sequence
Identical sequences A6ZXY7 B3LGP1 C7GLX3 E7KAL1 E7QCP5 G2WAD0 N1P628 P07284 W7PNS3
YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W 4932.YDR023W tr|A6ZXY7|A6ZXY7_YEAS7 YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W YDR023W SCRT_00487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]