SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDR029W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR029W   Protein: S000002436
Sequence length 104
Comment YDR029W SGDID:S000002436, Chr IV from 501098-501412, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MSKYYILIELMNDKKNTNSSCDIFSFYLNFSDNPFSSFRLKSRLLYGIFSCFLLFYSLKD
LIGVFKQKYLYLSILLLWLLVLLFCLAKGLSHNLRADSFLQYPL
Download sequence
Identical sequences Q12111
4932.YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]