SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR029W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR029W   Protein: S000002436
Sequence length 104
Comment YDR029W SGDID:S000002436, Chr IV from 501098-501412, Dubious ORF, "Dubious ORF unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MSKYYILIELMNDKKNTNSSCDIFSFYLNFSDNPFSSFRLKSRLLYGIFSCFLLFYSLKD
LIGVFKQKYLYLSILLLWLLVLLFCLAKGLSHNLRADSFLQYPL
Download sequence
Identical sequences Q12111
YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W 4932.YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W YDR029W

Jump to [ Top of page · Domain architecture · Domain assignment details ]