SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDR039C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR039C
Domain Number 1 Region: 17-128,270-361,805-1052
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 3.53e-100
Family Calcium ATPase, transmembrane domain M 0.0012
Further Details:      
 
Domain Number 2 Region: 366-385,590-864
Classification Level Classification E-value
Superfamily HAD-like 4.13e-49
Family Meta-cation ATPase, catalytic domain P 0.00017
Further Details:      
 
Domain Number 3 Region: 374-408,437-647
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.1e-47
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0026
Further Details:      
 
Domain Number 4 Region: 128-239
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.28e-27
Family Calcium ATPase, transduction domain A 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YDR039C   Protein: S000002446
Sequence length 1091
Comment ENA2 SGDID:S000002446, Chr IV from 534580-531305, reverse complement, Verified ORF, "P-type ATPase sodium pump, involved in Na+ efflux to allow salt tolerance; likely not involved in Li+ efflux"
Sequence
MSEGTVKENNNEEFNAYHTLTTEEAAEFIGTSLTEGLTQDESLRRLKAVGENTLGDDTKI
DYKAMVLHQVCNAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMN
SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT
GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL
QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII
VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL
GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS
HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD
PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST
VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL
SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK
KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV
DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCAMTGDGVNDSPSLKMANVGIAMGINGSD
VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN
GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY
GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE
VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK
PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPFEAYSTSTT
IHTEVNIGIKQ
Download sequence
Identical sequences Q01896
4215 4932.YDR039C YDR039C YDR039C YDR039C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]