SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR040C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR040C
Domain Number 1 Region: 17-128,270-361,805-1052
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.35e-101
Family Calcium ATPase, transmembrane domain M 0.0015
Further Details:      
 
Domain Number 2 Region: 366-385,590-864
Classification Level Classification E-value
Superfamily HAD-like 2.39e-48
Family Meta-cation ATPase, catalytic domain P 0.00018
Further Details:      
 
Domain Number 3 Region: 374-408,437-647
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.1e-47
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0026
Further Details:      
 
Domain Number 4 Region: 128-239
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.28e-27
Family Calcium ATPase, transduction domain A 0.00023
Further Details:      
 

Protein sequence

External link(s) Locus: YDR040C   Protein: S000002447
Sequence length 1091
Comment ENA1 SGDID:S000002447, Chr IV from 538465-535190, reverse complement, Verified ORF, "P-type ATPase sodium pump, involved in Na+ and Li+ efflux to allow salt tolerance"
Sequence
MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKI
DYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMN
SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT
GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL
QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII
VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL
GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS
HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD
PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST
VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL
SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK
KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV
DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD
VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN
GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY
GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE
VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK
PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPFEAYSTSTT
IHTEVNIGIKQ
Download sequence
Identical sequences P13587
YDR040C 4932.YDR040C YDR040C YDR040C

Jump to [ Top of page · Domain architecture · Domain assignment details ]