SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR040C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR040C
Domain Number 1 Region: 17-128,270-361,805-1052
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.35e-101
Family Calcium ATPase, transmembrane domain M 0.0015
Further Details:      
 
Domain Number 2 Region: 366-385,590-864
Classification Level Classification E-value
Superfamily HAD-like 2.39e-48
Family Meta-cation ATPase, catalytic domain P 0.00018
Further Details:      
 
Domain Number 3 Region: 374-408,437-647
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.1e-47
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0026
Further Details:      
 
Domain Number 4 Region: 128-239
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.28e-27
Family Calcium ATPase, transduction domain A 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YDR040C   Protein: S000002447
Sequence length 1091
Comment ENA1 SGDID:S000002447, Chr IV from 538465-535190, reverse complement, Verified ORF, "P-type ATPase sodium pump, involved in Na+ and Li+ efflux to allow salt tolerance"
Sequence
MGEGTTKENNNAEFNAYHTLTAEEAAEFIGTSLTEGLTQDEFVHRLKTVGENTLGDDTKI
DYKAMVLHQVCNAMIMVLLISMIISFAMHDWITGGVISFVIAVNVLIGLVQEYKATKTMN
SLKNLSSPNAHVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLT
GESLPVSKDANLVFGKEEETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSL
QGDSGLISRDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAII
VMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVIVRKLDSLEAL
GAVNDICSDKTGTLTQGKMLARQIWIPRFGTITISNSDDPFNPNEGNVSLIPRFSPYEYS
HNEDGDVGILQNFKDRLYEKDLPEDIDMDLFQKWLETATLANIATVFKDDATDCWKAHGD
PTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIAEFPFDST
VKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETIRKNVYSL
SNEGLRVLGFASKSFTKDQVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVK
KFHQAGINVHMLTGDFVGTAKAIAQEVGILPTNLYHYSQEIVDSMVMTGSQFDGLSEEEV
DDLPVLPLVIARCSPQTKVRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSD
VSKEASDIVLSDDNFASILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLIIGLVFRDEN
GKSVFPLSPVEVLWIIVVTSCFPAMGLGLEKAAPDLMDRPPHDSEVGIFTWEVIIDTFAY
GIIMTGSCMASFTGSLYGINSGRLGHDCDGTYNSSCRDVYRSRSAAFATMTWCALILAWE
VVDMRRSFFRMHPDTDSPVKEFFRSIWGNQFLFWSIIFGFVSAFPVVYIPVINDKVFLHK
PIGAEWGLAIAFTIAFWIGAELYKCGKRRYFKTQRAHNPENDLESNNKRDPFEAYSTSTT
IHTEVNIGIKQ
Download sequence
Identical sequences P13587
YDR040C 4932.YDR040C YDR040C YDR040C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]