SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR059C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR059C
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily UBC-like 6.04e-63
Family UBC-related 0.00000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endosome 1.323 33.28
ubiquitin ligase complex 1.917 17.17
transferase complex 1.423 8.62
endosome membrane 1.968 7.72
chromosomal part 1.477 5.71
chromatin 1.822 5.71

Protein sequence

External link(s) Locus: YDR059C   Protein: S000002466
Sequence length 148
Comment UBC5 SGDID:S000002466, Chr IV from 569769-569723,569632-569233, reverse complement, Verified ORF, "Ubiquitin-conjugating enzyme that mediates selective degradation of short-lived and abnormal proteins, central component of the cellular stress response; expression is heat inducible"
Sequence
MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD
YPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPL
VPEIAQIYKTDKAKYEATAKEWTKKYAV
Download sequence
Identical sequences A6ZY24 G2WAG3 N1PAC4 P15732
YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C 4932.YDR059C YDR059C tr|A6ZY24|A6ZY24_YEAS7 YDR059C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]