SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR059C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR059C
Domain Number 1 Region: 3-147
Classification Level Classification E-value
Superfamily UBC-like 6.04e-63
Family UBC-related 2.4e-07
Further Details:      
 

Protein sequence

External link(s) Locus: YDR059C   Protein: S000002466
Sequence length 148
Comment UBC5 SGDID:S000002466, Chr IV from 569769-569723,569632-569233, reverse complement, Verified ORF, "Ubiquitin-conjugating enzyme that mediates selective degradation of short-lived and abnormal proteins, central component of the cellular stress response; expression is heat inducible"
Sequence
MSSSKRIAKELSDLGRDPPASCSAGPVGDDLYHWQASIMGPSDSPYAGGVFFLSIHFPTD
YPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDPL
VPEIAQIYKTDKAKYEATAKEWTKKYAV
Download sequence
Identical sequences A6ZY24 G2WAG3 N1PAC4 P15732
YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C YDR059C 4932.YDR059C YDR059C YDR059C YDR059C tr|A6ZY24|A6ZY24_YEAS7 YDR059C YDR059C YDR059C YDR059C

Jump to [ Top of page · Domain architecture · Domain assignment details ]