SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR062W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR062W
Domain Number 1 Region: 105-524
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.32e-93
Family GABA-aminotransferase-like 9.17e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YDR062W   Protein: S000002469
Sequence length 561
Comment LCB2 SGDID:S000002469, Chr IV from 576472-578157, Verified ORF, "Component of serine palmitoyltransferase, responsible along with Lcb1p for the first committed step in sphingolipid synthesis, which is the condensation of serine with palmitoyl-CoA to form 3-ketosphinganine"
Sequence
MSTPANYTRVPLCEPEELPDDIQKENEYGTLDSPGHLYQVKSRHGKPLPEPVVDTPPYYI
SLLTYLNYLILIILGHVHDFLGMTFQKNKHLDLLEHDGLAPWFSNFESFYVRRIKMRIDD
CFSRPTTGVPGRFIRCIDRISHNINEYFTYSGAVYPCMNLSSYNYLGFAQSKGQCTDAAL
ESVDKYSIQSGGPRAQIGTTDLHIKAEKLVARFIGKEDALVFSMGYGTNANLFNAFLDKK
CLVISDELNHTSIRTGVRLSGAAVRTFKHGDMVGLEKLIREQIVLGQPKTNRPWKKILIC
AEGLFSMEGTLCNLPKLVELKKKYKCYLFIDEAHSIGAMGPTGRGVCEIFGVDPKDVDIL
MGTFTKSFGAAGGYIAADQWIIDRLRLDLTTVSYSESMPAPVLAQTISSLQTISGEICPG
QGTERLQRIAFNSRYLRLALQRLGFIVYGVADSPVIPLLLYCPSKMPAFSRMMLQRRIAV
VVVAYPATPLIESRVRFCMSASLTKEDIDYLLRHVSEVGDKLNLKSNSGKSSYDGKRQRW
DIEEVIRRTPEDCKDDKYFVN
Download sequence
Identical sequences B3LGK8 B5VFW1 C7GVS4 C8Z4Y1 P40970
YDR062W 4932.YDR062W YDR062W YDR062W SCRT_00453 YDR062W YDR062W YDR062W YDR062W YDR062W YDR062W

Jump to [ Top of page · Domain architecture · Domain assignment details ]