SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR069C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR069C
Domain Number 1 Region: 561-922
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.49e-93
Family Ubiquitin carboxyl-terminal hydrolase, UCH 1.24e-06
Further Details:      
 
Domain Number 2 Region: 185-324
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.98e-14
Family Cell cycle control phosphatase, catalytic domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.333 16.98
sarcolemma 1.911 11.85
endosome 1.322 9.81
cilium part 1.917 9.23
secretory granule 1.826 8.63
chloroplast part 1.896 8.35
endocytic vesicle 1.434 7.62
vacuolar part 1.621 7.6
centrosome 1.805 7.54
sperm part 2.207 6.8

Protein sequence

External link(s) Locus: YDR069C   Protein: S000002476
Sequence length 926
Comment DOA4 SGDID:S000002476, Chr IV from 587718-584938, reverse complement, Verified ORF, "Ubiquitin isopeptidase, required for recycling ubiquitin from proteasome-bound ubiquitinated intermediates, acts at the late endosome/prevacuolar compartment to recover ubiquitin from ubiquitinated membrane proteins en route to the vacuole"
Sequence
MEQNIISTIRDECIRHRSKYLTIAQLTAIAEAKINEFIITGKAKDQDLSSLLDKCIDILS
IYKKNSKDIKNIISCKNKGAMISSNSVMIIQLNYVYYKVIHIIVTTNIPHLSEFAKIKLH
KSTSDEGNGNNNNNEFQLMNIYNTLLETLLKDENIAKIKSFIKSSIKQTKLNHEQEECNL
MRTGSYITSNQLNSLISSSANSASSQMEILLIDIRSRLEFNKSHIDTKNIICLEPISFKM
SYSDHDLEKKSLITSPNSEIKMFQSRNLFKFIILYTDANEYNVKQQSVLLDILVNHSFEK
PISDDFTKIFILESGFPGWLKSNYGRQVSSSFPSNNNIKDDSVYINGNTSGLSLQHLPKM
SPSIRHSMDDSMKEMLVAPTPLNHLQQQQQQQSDNDHVLKRSSSFKKLFSNYTSPNPKNS
NSNLYSISSLSISSSPSPLPLHSPDPVKGNSLPINYPETPHLWKNSETDFMTNQREQLNH
NSFAHIAPINTKAITSPSRTATPKLQRFPQTISMNLNMNSNGHSSATSTIQPSCLSLSNN
DSLDHTDVTPTSSHNYDLDFAVGLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHIN
INSKLGSKGILAKYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQ
EFCQFLLDGLHEDLNQCGSNPPLKELSQEAEARREKLSLRIASSIEWERFLTTDFSVIVD
LFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNSRNNITIEDCFREFTKCENLEVDE
QWLCPHCEKRQPSTKQLTITRLPRNLIVHLKRFDNLLNKNNDFVIYPFLLDLTPFWANDF
DGVFPPGVNDDELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTK
YKPVKNKADAINSNAYVLFYHRVYGV
Download sequence
Identical sequences C8Z4Y7 P32571
YDR069C YDR069C 4932.YDR069C YDR069C YDR069C YDR069C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]