SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR073W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR073W   Protein: S000002480
Sequence length 169
Comment SNF11 SGDID:S000002480, Chr IV from 592437-592946, Verified ORF, "Subunit of the SWI/SNF chromatin remodeling complex involved in transcriptional regulation; interacts with a highly conserved 40-residue sequence of Snf2p"
Sequence
MSSEIAYSNTNTNTENENRNTGAGVDVNTNANANANATANATANATANATAELNLPTVDE
QRQYKVQLLLHINSILLARVIQMNNSLQNNLQNNINNSNNNNIIRIQQLISQFLKRVHAN
LQCISQINQGVPSAKPLILTPPQLANQQQPPQDILSKLYLLLARVFEIW
Download sequence
Identical sequences P38956
YDR073W YDR073W 4932.YDR073W YDR073W APC7677 YDR073W YDR073W

Jump to [ Top of page · Domain architecture · Domain assignment details ]