SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR073W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR073W   Protein: S000002480
Sequence length 169
Comment SNF11 SGDID:S000002480, Chr IV from 592437-592946, Verified ORF, "Subunit of the SWI/SNF chromatin remodeling complex involved in transcriptional regulation; interacts with a highly conserved 40-residue sequence of Snf2p"
Sequence
MSSEIAYSNTNTNTENENRNTGAGVDVNTNANANANATANATANATANATAELNLPTVDE
QRQYKVQLLLHINSILLARVIQMNNSLQNNLQNNINNSNNNNIIRIQQLISQFLKRVHAN
LQCISQINQGVPSAKPLILTPPQLANQQQPPQDILSKLYLLLARVFEIW
Download sequence
Identical sequences P38956
APC7677 YDR073W YDR073W YDR073W YDR073W 4932.YDR073W YDR073W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]