SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR075W
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.3e-114
Family Protein serine/threonine phosphatase 0.0000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
phosphoric ester hydrolase activity 1.494 73.46
nuclease activity 1.598 66.28
calmodulin binding 2.02 28.18
phosphatase binding 1.981 25.82
drug binding 1.996 23.83
phospholipid binding 1.435 13.42
phosphoric diester hydrolase activity 1.864 11.91
phospholipase activity 1.966 11.33
manganese ion binding 2.154 7.99
iron ion binding 1.952 7.12
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR075W   Protein: S000002482
Sequence length 308
Comment PPH3 SGDID:S000002482, Chr IV from 597154-598080, Verified ORF, "Catalytic subunit of an evolutionarily conserved protein phosphatase complex containing Psy2p and the regulatory subunit Psy4p; required for cisplatin resistance; involved in activation of Gln3p"
Sequence
MMDLDKIIASLRDGKHIPEETVFRLCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLL
TLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKV
YGFYDEVVRKYGNSNVWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRK
QEVPHEGAMCDLLWSDPEDVDTWSLSPRGAGFLFGKREVDQFLEKNNVELIARAHQLVME
GYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYTIFEAVQAQNEVGNAIIPTK
KSQMDYFL
Download sequence
Identical sequences A0A0L8VTI3 A6ZY40 B3LGJ5 B5VFX1 C7GVR2 C8Z4Z3 G2WAH9 H0GE33 P32345
YDR075W YDR075W YDR075W YDR075w___KOG0372 YDR075W YDR075W YDR075W YDR075W YDR075W 4932.YDR075W YDR075W YDR075W SCRT_00440 YDR075W YDR075W tr|A6ZY40|A6ZY40_YEAS7 YDR075W YDR075W YDR075W YDR075W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]