SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR075W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR075W
Domain Number 1 Region: 1-288
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.3e-114
Family Protein serine/threonine phosphatase 2.63e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YDR075W   Protein: S000002482
Sequence length 308
Comment PPH3 SGDID:S000002482, Chr IV from 597154-598080, Verified ORF, "Catalytic subunit of an evolutionarily conserved protein phosphatase complex containing Psy2p and the regulatory subunit Psy4p; required for cisplatin resistance; involved in activation of Gln3p"
Sequence
MMDLDKIIASLRDGKHIPEETVFRLCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLL
TLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKV
YGFYDEVVRKYGNSNVWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRK
QEVPHEGAMCDLLWSDPEDVDTWSLSPRGAGFLFGKREVDQFLEKNNVELIARAHQLVME
GYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIDDDLNREYTIFEAVQAQNEVGNAIIPTK
KSQMDYFL
Download sequence
Identical sequences A6ZY40 B3LGJ5 B5VFX1 C7GVR2 C8Z4Z3 G2WAH9 H0GE33 P32345 W7PNV8
YDR075W YDR075W YDR075W YDR075W YDR075W YDR075W YDR075W YDR075W YDR075W YDR075W 4932.YDR075W YDR075W SCRT_00440 YDR075W YDR075W tr|A6ZY40|A6ZY40_YEAS7 YDR075W YDR075w___KOG0372 YDR075W YDR075W

Jump to [ Top of page · Domain architecture · Domain assignment details ]