SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR091C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR091C
Domain Number 1 Region: 372-541
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.94e-33
Family ABC transporter ATPase domain-like 0.00064
Further Details:      
 
Domain Number 2 Region: 101-159,191-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.29e-30
Family ABC transporter ATPase domain-like 0.0024
Further Details:      
 
Domain Number 3 Region: 7-143
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.72e-15
Family Short-chain ferredoxins 0.051
Further Details:      
 

Protein sequence

External link(s) Locus: YDR091C   Protein: S000002498
Sequence length 608
Comment RLI1 SGDID:S000002498, Chr IV from 628532-626706, reverse complement, Verified ORF, "Essential iron-sulfur protein required for ribosome biogenesis and translation initiation; facilitates binding of a multifactor complex (MFC) of translation initiation factors to the small ribosomal subunit; predicted ABC family ATPase"
Sequence
MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI
CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA
DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV
YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK
KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ
KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL
ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGNY
FFLDNTGI
Download sequence
Identical sequences A6ZY57 B3LGI0 B5VFY8 C7GVP5 E7LSM2 G2WAJ6 H0GE47 Q03195
YDR091C YDR091C YDR091C YDR091C YDR091C YDR091C YDR091C YDR091C 4932.YDR091C YDR091C SCRT_00423 YDR091C YDR091C tr|A6ZY57|A6ZY57_YEAS7 3j16.B YDR091C YDR091C YDR091C YDR091C

Jump to [ Top of page · Domain architecture · Domain assignment details ]