SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YDR091C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR091C
Domain Number 1 Region: 372-541
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.94e-33
Family ABC transporter ATPase domain-like 0.00064
Further Details:      
 
Domain Number 2 Region: 101-159,191-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.29e-30
Family ABC transporter ATPase domain-like 0.0024
Further Details:      
 
Domain Number 3 Region: 7-143
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000272
Family Short-chain ferredoxins 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
respiratory chain 2.14 21.17
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42

Protein sequence

External link(s) Locus: YDR091C   Protein: S000002498
Sequence length 608
Comment RLI1 SGDID:S000002498, Chr IV from 628532-626706, reverse complement, Verified ORF, "Essential iron-sulfur protein required for ribosome biogenesis and translation initiation; facilitates binding of a multifactor complex (MFC) of translation initiation factors to the small ribosomal subunit; predicted ABC family ATPase"
Sequence
MSDKNSRIAIVSADKCKPKKCRQECKRSCPVVKTGKLCIEVTPTSKIAFISEILCIGCGI
CVKKCPFDAIQIINLPTNLEAHVTHRYSANSFKLHRLPTPRPGQVLGLVGTNGIGKSTAL
KILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKMLEDDIKAIIKPQYVDNIPRAI
KGPVQKVGELLKLRMEKSPEDVKRYIKILQLENVLKRDIEKLSGGELQRFAIGMSCVQEA
DVYMFDEPSSYLDVKQRLNAAQIIRSLLAPTKYVICVEHDLSVLDYLSDFVCIIYGVPSV
YGVVTLPASVREGINIFLDGHIPAENLRFRTEALQFRIADATEDLQNDSASRAFSYPSLK
KTQGDFVLNVEEGEFSDSEILVMMGENGTGKTTLIKLLAGALKPDEGQDIPKLNVSMKPQ
KIAPKFPGTVRQLFFKKIRGQFLNPQFQTDVVKPLRIDDIIDQEVQHLSGGELQRVAIVL
ALGIPADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKTAFIVEHDFIMATYLADKVIV
FEGIPSKNAHARAPESLLTGCNRFLKNLNVTFRRDPNSFRPRINKLDSQMDKEQKSSGNY
FFLDNTGI
Download sequence
Identical sequences A6ZY57 B3LGI0 B5VFY8 C7GVP5 E7LSM2 G2WAJ6 H0GE47 Q03195 W7PNX4
YDR091C YDR091C YDR091C 3j16.B 4crm.P YDR091C YDR091C SCRT_00423 YDR091C YDR091C YDR091C YDR091C 4932.YDR091C YDR091C YDR091C YDR091C YDR091C tr|A6ZY57|A6ZY57_YEAS7 YDR091C YDR091C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]