SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR123C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR123C
Domain Number 1 Region: 230-301
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000048
Family HLH, helix-loop-helix DNA-binding domain 0.0067
Further Details:      
 

Protein sequence

External link(s) Locus: YDR123C   Protein: S000002530
Sequence length 304
Comment INO2 SGDID:S000002530, Chr IV from 699466-698552, reverse complement, Verified ORF, "Component of the heteromeric Ino2p/Ino4p basic helix-loop-helix transcription activator that binds inositol/choline-responsive elements (ICREs), required for derepression of phospholipid biosynthetic genes in response to inositol depletion"
Sequence
MQQATGNELLGILDLDNDIDFETAYQMLSSNFDDQMSAHIHENTFSATSPPLLTHELGII
PNVATVQPSHVETIPADNQTHHAPLHTHAHYLNHNPHQPSMGFDQALGLKLSPSSSGLLS
TNESNAIEQFLDNLISQDMMSSNASMNSESHLHIRSPKKQHRYTELNQRYPETHPHSNTG
ELPTNTADVPTEFTTREGPHQPIGNDHYNPPPFSVPEIRIPDSDIPANIEDDPVKVRKWK
HVQMEKIRRINTKEAFERLIKSVRTPPKENGKRIPKHILLTCVMNDIKSIRSANEALQHI
LDDS
Download sequence
Identical sequences B3LGF3 B5VG18 C7GIN1 C8Z539 E7LSN8 E7QCV4 P26798 W7PNZ0
YDR123C 4932.YDR123C YDR123C YDR123C SCRT_00395 YDR123C YDR123C YDR123C YDR123C YDR123C YDR123C YDR123C CX00022 YT392 YDR123C

Jump to [ Top of page · Domain architecture · Domain assignment details ]