SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR123C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR123C
Domain Number 1 Region: 230-301
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.8e-09
Family HLH, helix-loop-helix DNA-binding domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transcription factor complex 1.881 50.02
nucleoplasm part 1.419 32.56
ribonucleoprotein complex 1.415 23.17
nuclear chromosome 1.723 12.84
chromosomal part 1.478 12.84
methyltransferase complex 2.218 9.69
ribonucleoprotein granule 1.998 4.41
chromatin 1.906 4.1

Protein sequence

External link(s) Locus: YDR123C   Protein: S000002530
Sequence length 304
Comment INO2 SGDID:S000002530, Chr IV from 699466-698552, reverse complement, Verified ORF, "Component of the heteromeric Ino2p/Ino4p basic helix-loop-helix transcription activator that binds inositol/choline-responsive elements (ICREs), required for derepression of phospholipid biosynthetic genes in response to inositol depletion"
Sequence
MQQATGNELLGILDLDNDIDFETAYQMLSSNFDDQMSAHIHENTFSATSPPLLTHELGII
PNVATVQPSHVETIPADNQTHHAPLHTHAHYLNHNPHQPSMGFDQALGLKLSPSSSGLLS
TNESNAIEQFLDNLISQDMMSSNASMNSESHLHIRSPKKQHRYTELNQRYPETHPHSNTG
ELPTNTADVPTEFTTREGPHQPIGNDHYNPPPFSVPEIRIPDSDIPANIEDDPVKVRKWK
HVQMEKIRRINTKEAFERLIKSVRTPPKENGKRIPKHILLTCVMNDIKSIRSANEALQHI
LDDS
Download sequence
Identical sequences B3LGF3 B5VG18 C7GIN1 C8Z539 E7LSN8 E7QCV4 P26798 W7PNZ0
YDR123C 4932.YDR123C YDR123C YDR123C SCRT_00395 YDR123C YDR123C YDR123C YDR123C YDR123C YDR123C YDR123C CX00022 YT392 YDR123C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]