SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR146C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR146C
Domain Number 1 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-11
Family Classic zinc finger, C2H2 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.419 14.78
nucleolus 1.651 6.38
SWI/SNF superfamily-type complex 2.177 5.46
chromosomal part 1.478 5.28
ribonucleoprotein complex 1.415 5.06
small nuclear ribonucleoprotein complex 2.004 5.06
chromatin 1.906 4.81
nuclear body 1.911 3.96

Protein sequence

External link(s) Locus: YDR146C   Protein: S000002553
Sequence length 709
Comment SWI5 SGDID:S000002553, Chr IV from 750740-748611, reverse complement, Verified ORF, "Transcription factor that activates transcription of genes expressed at the M/G1 phase boundary and in G1 phase; localization to the nucleus occurs during G1 and appears to be regulated by phosphorylation by Cdc28p kinase"
Sequence
MDTSNSWFDASKVQSLNFDLQTNSYYSNARGSDPSSYAIEGEYKTLATDDLGNILNLNYG
ETNEVIMNEINDLNLPLGPLSDEKSVKVSTFSELIGNDWQSMNFDLENNSREVTLNATSL
LNENRLNQDSGMTVYQKTMSDKPHDEKKISMADNLLSTINKSEINKGFDRNLGELLLQQQ
QELREQLRAQQEANKKLELELKQTQYKQQQLQATLENSDGPQFLSPKRKISPASENVEDV
YANSLSPMISPPMSNTSFTGSPSRRNNRQKYCLQRKNSSGTVGPLCFQELNEGFNDSLIS
PKKIRSNPNENLSSKTKFITPFTPKSRVSSATSNSANITPNNLRLDFKINVEDQESEYSE
KPLGLGIELLGKPGPSPTKSVSLKSASVDIMPTIPGSVNNTPSVNKVSLSSSYIDQYTPR
GKQLHFSSISENALGINAATPHLKPPSQQARHREGVFNDLDPNVLTKNTDNEGDDNEENE
PESRFVISETPSPVLKSQSKYEGRSPQFGTHIKEINTYTTNSPSKITRKLTTLPRGSIDK
YVKEMPDKTFECLFPGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRH
KKSHQEKAYACPCGKKFNREDALVVHRSRMICSGGKKYENVVIKRSPRKRGRPRKDGTSS
VSSSPIKENINKDHNGQLMFKLEDQLRRERSYDGNGTGIMVSPMKTNQR
Download sequence
Identical sequences E7NFR8 G2WAP6 N1P8A2 P08153
YDR146C YDR146C 4932.YDR146C YDR146C YDR146C YDR146C YDR146C YDR146C YDR146C YDR146C YDR146C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]