SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR169C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR169C-A   Protein: S000028538
Sequence length 49
Comment YDR169C-A SGDID:S000028538, Chr IV from 794721-794572, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR"
Sequence
MMRMSLKQMQSQRFSATSRVRMLLIGASGLRSSSSKLECPRFSNKHGRN
Download sequence
Identical sequences Q3E789
YDR169C-A YDR169C-A 4932.YDR169C-A YDR169C-A YDR169C-A YDR169C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]