SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR169C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR169C-A   Protein: S000028538
Sequence length 49
Comment YDR169C-A SGDID:S000028538, Chr IV from 794721-794572, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR"
Sequence
MMRMSLKQMQSQRFSATSRVRMLLIGASGLRSSSSKLECPRFSNKHGRN
Download sequence
Identical sequences Q3E789
4932.YDR169C-A YDR169C-A YDR169C-A YDR169C-A YDR169C-A YDR169C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]