SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR170W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR170W-A   Protein: S000007227
Sequence length 440
Comment YDR170W-A SGDID:S000007227, Chr IV from 803193-804515, transposable_element_gene, "Retrotransposon TYA Gag gene; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag; YDR170W-A is part of a mutant retrotransposon"
Sequence
MESQQLSQHSPISHGSACASVTSKEVQTTQDPLDISASKTEECEKVFTQANSQQPTTPPS
AAVPENHHHASPQAAQVPLPQNGPYPQQRMMTPQQANISGWPVYGHPSLMPYPPYQMSPM
YAPPGAQSQFTQYPQYVGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPND
FLNWVKIYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFALSQFLPTWVKDI
LSVDYTDIMKILSKSINKMQSDTQEVNDITTLANLHYNGSTPADAFEAEVTNILDRLKNN
GIPINNKVACQFIMRGLSGEYKFLRYARHRYIHMTVADLFSDIHSMYEEQQESKRNKSTY
RRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTSNNFPGPDNDLIRGS
TTEPIQLKNKHDLHLRPGTY
Download sequence
Identical sequences B3LGB3 E7Q281 Q03964
YDR170W-A YDR170W-A SCRT_00351 YDR170W-A YDR170W-A YDR170W-A YDR170W-A YDR170W-A 4932.YDR170W-A YDR170W-A YBL005W-A YDR170W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]