SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR170W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR170W-A   Protein: S000007227
Sequence length 440
Comment YDR170W-A SGDID:S000007227, Chr IV from 803193-804515, transposable_element_gene, "Retrotransposon TYA Gag gene; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag; YDR170W-A is part of a mutant retrotransposon"
Sequence
MESQQLSQHSPISHGSACASVTSKEVQTTQDPLDISASKTEECEKVFTQANSQQPTTPPS
AAVPENHHHASPQAAQVPLPQNGPYPQQRMMTPQQANISGWPVYGHPSLMPYPPYQMSPM
YAPPGAQSQFTQYPQYVGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPND
FLNWVKIYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFALSQFLPTWVKDI
LSVDYTDIMKILSKSINKMQSDTQEVNDITTLANLHYNGSTPADAFEAEVTNILDRLKNN
GIPINNKVACQFIMRGLSGEYKFLRYARHRYIHMTVADLFSDIHSMYEEQQESKRNKSTY
RRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTSNNFPGPDNDLIRGS
TTEPIQLKNKHDLHLRPGTY
Download sequence
Identical sequences B3LGB3 E7Q281 Q03964
YDR170W-A 4932.YDR170W-A YDR170W-A YDR170W-A SCRT_00351 YDR170W-A YDR170W-A YDR170W-A YDR170W-A YDR170W-A YBL005W-A YDR170W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]