SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR171W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR171W
Domain Number 1 Region: 240-355
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.33e-17
Family HSP20 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cilium 1.573 21.71
ciliary part 1.844 21.71
chromosomal part 1.477 4.48
chromosomal region 1.98 4.48
Biological Process IC (bits) H-Score
response to heat 1.968 48.99
protein phosphorylation 1.432 45.94
response to temperature stimulus 1.67 34.95
cellular macromolecular complex assembly 1.466 34.1
response to hydrogen peroxide 2.247 28.71
cell fate commitment 1.398 27.52
cell proliferation 1.38 27.52
cell division 1.424 27.52
stem cell proliferation 2.047 27.52
stem cell division 2.089 27.52

Protein sequence

External link(s) Locus: YDR171W   Protein: S000002578
Sequence length 375
Comment HSP42 SGDID:S000002578, Chr IV from 806619-807746, Verified ORF, "Small heat shock protein (sHSP) with chaperone activity; forms barrel-shaped oligomers that suppress unfolded protein aggregation; involved in cytoskeleton reorganization after heat shock"
Sequence
MSFYQPSLSLYDVLNALSNQTGQRGQQGYPRQPQRPQRYHPHYGQVHVGGHHPRHHPLYS
RYNGVPNTYYYQFPGQAYYYSPEYGYDDEDGEEEDQDEDMVGDSGTTRQEDGGEDSNSRR
YPSYYHCNTARNNRTNQQANSLNDLLTALIGVPPYEGTEPEIEANTEQEGEKGEEKDKKD
KSEAPKEEAGETNKEKPLNQLEESSRPPLAKKSSSFAHLQAPSPIPDPLQVSKPETRMDL
PFSPEVNVYDTEDTYVVVLALPGANSRAFHIDYHPSSHEMLIKGKIEDRVGIDEKFLKIT
ELKYGAFERTVKFPVLPRIKDEEIKATYNNGLLQIKVPKIVNDTEKPKPKKRIAIEEIPD
EELEFEENPNPTVEN
Download sequence
Identical sequences B3LGB2 B5VG66 E7KAX7 E7KLP7 E7Q283 E7QCY6 Q12329 W7PWF2
YDR171W YDR171W YDR171W 4932.YDR171W YDR171W YDR171W YDR171W SCRT_00350 YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]