SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR171W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR171W
Domain Number 1 Region: 240-355
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.33e-17
Family HSP20 0.0095
Further Details:      
 

Protein sequence

External link(s) Locus: YDR171W   Protein: S000002578
Sequence length 375
Comment HSP42 SGDID:S000002578, Chr IV from 806619-807746, Verified ORF, "Small heat shock protein (sHSP) with chaperone activity; forms barrel-shaped oligomers that suppress unfolded protein aggregation; involved in cytoskeleton reorganization after heat shock"
Sequence
MSFYQPSLSLYDVLNALSNQTGQRGQQGYPRQPQRPQRYHPHYGQVHVGGHHPRHHPLYS
RYNGVPNTYYYQFPGQAYYYSPEYGYDDEDGEEEDQDEDMVGDSGTTRQEDGGEDSNSRR
YPSYYHCNTARNNRTNQQANSLNDLLTALIGVPPYEGTEPEIEANTEQEGEKGEEKDKKD
KSEAPKEEAGETNKEKPLNQLEESSRPPLAKKSSSFAHLQAPSPIPDPLQVSKPETRMDL
PFSPEVNVYDTEDTYVVVLALPGANSRAFHIDYHPSSHEMLIKGKIEDRVGIDEKFLKIT
ELKYGAFERTVKFPVLPRIKDEEIKATYNNGLLQIKVPKIVNDTEKPKPKKRIAIEEIPD
EELEFEENPNPTVEN
Download sequence
Identical sequences B3LGB2 B5VG66 E7KAX7 E7KLP7 E7Q283 E7QCY6 Q12329
YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W YDR171W 4932.YDR171W YDR171W SCRT_00350 YDR171W YDR171W

Jump to [ Top of page · Domain architecture · Domain assignment details ]