SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR195W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR195W   Protein: S000002603
Sequence length 533
Comment REF2 SGDID:S000002603, Chr IV from 848597-850198, Verified ORF, "RNA-binding protein involved in the cleavage step of mRNA 3'-end formation prior to polyadenylation, and in snoRNA maturation; part of holo-CPF subcomplex APT, which associates with 3'-ends of snoRNA- and mRNA-encoding genes"
Sequence
MSAPVPQLVNISHALQASTIQQIRLDMVDFNKDCKLSSIQLARIDKYIDSLQAALNQFTK
DNLHIERKEKNVTEADIQLYSGLKSMYLDYLNQLIKLKHEKQHHSTPPIANDVSLDFFVN
QLPKFSPEERKNYIDNLILNKNSHNRLSKMDGLVDAVINLCVLDTSVAENVRSYMKLLDT
LGFQKGSNSTGTKANLKKKLASSKAKIKDSEKEKEKEKDKSKVKMKTKLKPSPLLNNDDK
NSSPSPTASTSSMKKLKSGLFNKNEAKSTESLPTSSKKKLSFSKYLNKDDADMTKLGTKR
SIDVDFKVNPEASTVASNIISSSTSGSSTTTVATPASSEEPLKKKTKISVQDSNVQSILR
NGKPKKARISSIKFLDDSQLIKVYGDDLPNQGLQVSPTQLKKILKPFKEGEPKEIILFED
MSIKLKPLDLMFLKNTNSDDYMDISETKGGPIHCETRTPLIYRKNFNHFNPDLNKRPPRE
PIEFDLNGNTNSTPTIAKAFGKNSLLLRKDRGGLPYKHVPIVKRNKYPPRPVH
Download sequence
Identical sequences B3LG88 C7GN02 N1P6J0 P42073
YDR195W 4932.YDR195W YDR195W YDR195W SCRT_00325 YDR195W YDR195W

Jump to [ Top of page · Domain architecture · Domain assignment details ]