SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR207C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR207C
Domain Number 1 Region: 762-803
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 2.49e-10
Family Zn2/Cys6 DNA-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  YDR207C
Domain Number - Region: 799-832
Classification Level Classification E-value
Superfamily Stathmin 0.0275
Family Stathmin 0.0097
Further Details:      
 

Protein sequence

External link(s) Locus: YDR207C   Protein: S000002615
Sequence length 836
Comment UME6 SGDID:S000002615, Chr IV from 867520-865010, reverse complement, Verified ORF, "Key transcriptional regulator of early meiotic genes, binds URS1 upstream regulatory sequence, couples metabolic responses to nutritional cues with initiation and progression of meiosis, forms complex with Ime1p, and also with Sin3p-Rpd3p"
Sequence
MLDKARSQSKHMDESNAAASLLSMETTANNHHYLHNKTSRATLMNSSQDGKKHAEDEVSD
GANSRHPTISSASIESLKTTYDENPLLSIMKSTCAPNNTPVHTPSGSPSLKVQSGGDIKD
DPKENDTTTTTNTTLQDRRDSDNAVHAAASPLAPSNTPSDPKSLCNGHVAQATDPQISGA
IQPQYTATNEDVFPYSSTSTNSNTATTTIVAGAKKKIHLPPPQAPAVSSPGTTAAGSGAG
TGSGIRSRTGSDLPLIITSANKNNGKTTNSPMSILSRNNSTNNNDNNSIQSSDSRESSNN
NEIGGYLRGGTKRGGSPSNDSQVQHNVHDDQCAVGVAPRNFYFNKDREITDPNVKLDENE
SKINISFWLNSKYRDEAYSLNESSSNNASSNTDTPTNSRHANTSSSITSRNNFQHFRFNQ
IPSQPPTSASSFTSTNNNNPQRNNINRGEDPFATSSRPSTGFFYGDLPNRNNRNSPFHTN
EQYIPPPPPKYINSKLDGLRSRLLLGPNSASSSTKLDDDLGTAAAVLSNMRSSPYRTHDK
PISNVNDMNNTNALGVPASRPHSSSFPSKGVLRPILLRIHNSEQQPIFESNNSTAVFDED
QDQNQDLSPYHLNLNSKKVLDPTFESRTRQVTWNKNGKRIDRRLSAPEQQQQLEVPPLKK
SRRSVGNARVASQTNSDYNSLGESSTSSAPSSPSLKASSGLAYTADYPNATSPDFAKSKG
KNVKPKAKSKAKQSSKKRPNNTTSKSKANNSQESNNATSSTSQGTRSRTGCWICRLRKKK
CTEERPHCFNCERLKLDCHYDAFKPDFVSDPKKKQMKLEEIKKKTKEAKRRAMKKK
Download sequence
Identical sequences N1P4Y9 P39001
YDR207C YDR207C 4932.YDR207C YDR207C YDR207C

Jump to [ Top of page · Domain architecture · Domain assignment details ]