SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR210W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR210W-A   Protein: S000007392
Sequence length 438
Comment YDR210W-A SGDID:S000007392, Chr IV from 872110-873426, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLHQNPHSQHGSAYASVTSKEVPSNQDPLAVSASNLPEFDRDSTKVNSQEETTPGT
SAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTCSHYQTSPA
YYQPDPHYPLPQYIPPLSTSSPDPIDSQDQHSEVPQAKTKVRNNVLPPHTLTSEENFSTW
VKFYIRFLKNSNLGDIIPNDQGEIKRQMTYEEHAYIYNTFQAFAPFHLLPTWVKQILEIN
YSDILTVLCKSVSKMQTNNQELKDWIALANLEYNGSTSADTFEITVSTIIQRLKENNINV
SDRLACQLILKGLSGDFKYLRNQYRTKTNMKLSQLFAEIQLIYDENKIMNLNKPSQYKQH
SEYKNVSRTSPNTTNTKVTTRNYHRTNSSKPRAAKAHNIATSSKFSRVNSDHINESTVSS
QYLSDDNELSLRPATERI
Download sequence
Identical sequences Q03483
YDR210W-A 4932.YDR210W-A YDR210W-A YDR210W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]