SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR232W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR232W
Domain Number 1 Region: 77-487
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5e-101
Family GABA-aminotransferase-like 2.57e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nuclear outer membrane-endoplasmic reticulum membrane network 1.559 41.9
endoplasmic reticulum part 1.433 41.9
mitochondrial matrix 1.707 9.9
mitochondrial envelope 1.571 5.13
mitochondrial inner membrane 1.752 5.13
organelle inner membrane 1.673 4.91
microbody 1.956 4.39
plastid 1.598 3.87

Protein sequence

External link(s) Locus: YDR232W   Protein: S000002640
Sequence length 548
Comment HEM1 SGDID:S000002640, Chr IV from 927449-929095, Verified ORF, "5-aminolevulinate synthase, catalyzes the first step in the heme biosynthetic pathway; an N-terminal signal sequence is required for localization to the mitochondrial matrix; expression is regulated by Hap2p-Hap3p"
Sequence
MQRSIFARFGNSSAAVSTLNRLSTTAAPHAKNGYATATGAGAAAATATASSTHAAAAAAA
AANHSTQESGFDYEGLIDSELQKKRLDKSYRYFNNINRLAKEFPLAHRQREADKVTVWCS
NDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFS
SCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQS
YPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHC
DFESHRASGIATPKTNDKGGAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFA
PGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIV
PVLIGNADLAKQASDILINKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAV
DDVFNELQLPRVRDWESQGGLLGVGESGFVEESNLWTSSQLSLTNDDLNPNVRDPIVKQL
EVSSGIKQ
Download sequence
Identical sequences P09950
YDR232W YDR232W 4932.YDR232W YDR232W YDR232W YDR232W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]