SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR232W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR232W
Domain Number 1 Region: 77-487
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5e-101
Family GABA-aminotransferase-like 2.57e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YDR232W   Protein: S000002640
Sequence length 548
Comment HEM1 SGDID:S000002640, Chr IV from 927449-929095, Verified ORF, "5-aminolevulinate synthase, catalyzes the first step in the heme biosynthetic pathway; an N-terminal signal sequence is required for localization to the mitochondrial matrix; expression is regulated by Hap2p-Hap3p"
Sequence
MQRSIFARFGNSSAAVSTLNRLSTTAAPHAKNGYATATGAGAAAATATASSTHAAAAAAA
AANHSTQESGFDYEGLIDSELQKKRLDKSYRYFNNINRLAKEFPLAHRQREADKVTVWCS
NDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFS
SCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQS
YPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHC
DFESHRASGIATPKTNDKGGAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFA
PGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIV
PVLIGNADLAKQASDILINKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAV
DDVFNELQLPRVRDWESQGGLLGVGESGFVEESNLWTSSQLSLTNDDLNPNVRDPIVKQL
EVSSGIKQ
Download sequence
Identical sequences P09950
YDR232W YDR232W 4932.YDR232W YDR232W YDR232W YDR232W

Jump to [ Top of page · Domain architecture · Domain assignment details ]