SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR233C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR233C   Protein: S000002641
Sequence length 295
Comment RTN1 SGDID:S000002641, Chr IV from 930354-929467, reverse complement, Verified ORF, "ER membrane protein that interacts with exocyst subunit Sec6p and with Yip3p; also interacts with Sbh1p; null mutant has an altered (mostly cisternal) ER morphology; member of the RTNLA (reticulon-like A) subfamily"
Sequence
MSASAQHSQAQQQQQQKSCNCDLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAY
TILFTTGSIEFVSKLFLGQGLITKYGPKECPNIAGFIKPHIDEALKQLPVFQAHIRKTVF
AQVPKHTFKTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQGVE
ISKQKTQEFSQMACEKTKPYLDKVESKLGPISNLVKSKTAPVSSTAGPQTASTSKLAADV
PLEPESKAYTSSAQVMPEVPQHEPSTTQEFNVDELSNELKKSTKNLQNELEKNNA
Download sequence
Identical sequences N1P514 Q04947
YDR233C YDR233C YDR233C YDR233C YDR233C YDR233C YDR233C 4932.YDR233C YDR233c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]