SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR233C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YDR233C   Protein: S000002641
Sequence length 295
Comment RTN1 SGDID:S000002641, Chr IV from 930354-929467, reverse complement, Verified ORF, "ER membrane protein that interacts with exocyst subunit Sec6p and with Yip3p; also interacts with Sbh1p; null mutant has an altered (mostly cisternal) ER morphology; member of the RTNLA (reticulon-like A) subfamily"
Sequence
MSASAQHSQAQQQQQQKSCNCDLLLWRNPVQTGKYFGGSLLALLILKKVNLITFFLKVAY
TILFTTGSIEFVSKLFLGQGLITKYGPKECPNIAGFIKPHIDEALKQLPVFQAHIRKTVF
AQVPKHTFKTAVALFLLHKFFSWFSIWTIVFVADIFTFTLPVIYHSYKHEIDATVAQGVE
ISKQKTQEFSQMACEKTKPYLDKVESKLGPISNLVKSKTAPVSSTAGPQTASTSKLAADV
PLEPESKAYTSSAQVMPEVPQHEPSTTQEFNVDELSNELKKSTKNLQNELEKNNA
Download sequence
Identical sequences N1P514 Q04947
YDR233C 4932.YDR233C YDR233C YDR233C YDR233C YDR233C YDR233c YDR233C YDR233C

Jump to [ Top of page · Domain architecture · Domain assignment details ]