SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR256C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR256C
Domain Number 1 Region: 17-500
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 8.9e-193
Family Heme-dependent catalases 0.00000000000000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microbody 1.856 34.47
cytosol 1.295 5.65
intracellular ribonucleoprotein complex 1.368 5.65
cytosolic ribosome 2.235 5.65
cell wall 1.824 5.11
external encapsulating structure 1.722 4.67
organelle envelope 1.405 3.94
plastid 1.525 3.94
Molecular Function IC (bits) H-Score
antioxidant activity 2.165 91.89
heme binding 2.02 12.4

Protein sequence

External link(s) Locus: YDR256C   Protein: S000002664
Sequence length 515
Comment CTA1 SGDID:S000002664, Chr IV from 969677-968130, reverse complement, Verified ORF, "Catalase A, breaks down hydrogen peroxide in the peroxisomal matrix formed by acyl-CoA oxidase (Pox1p) during fatty acid beta-oxidation"
Sequence
MSKLGQEKNEVNYSDVREDRVVTNSTGNPINEPFVTQRIGEHGPLLLQDYNLIDSLAHFN
RENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADT
VRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRDADMFWDF
LTTPENQVAIHQVMILFSDRGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIK
NLTIEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVW
PQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASADPVLQARLFSYADAHR
YRLGPNFHQIPVNCPYASKFFNPAIRDGPMNVNGNFGSEPTYLANDKSYTYIQQDRPIQQ
HQEVWNGPAIPYHWATSPGDVDFVQARNLYRVLGKQPGQQKNLAYNIGIHVEGACPQIQQ
RVYDMFARVDKGLSEAIKKVAEAKHASELSSNSKF
Download sequence
Identical sequences B3LG34 C7GTJ1 E7KB26 H0GE94 N1P8H9 P15202
YDR256C YDR256C YDR256C YDR256C YDR256C YDR256C 4932.YDR256C YDR256C YDR256C YDR256c___KOG0047 YDR256C SCRT_00270 YDR256C NP_010542.1 YDR256C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]