SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR256C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR256C
Domain Number 1 Region: 17-500
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 8.9e-193
Family Heme-dependent catalases 8.09e-15
Further Details:      
 

Protein sequence

External link(s) Locus: YDR256C   Protein: S000002664
Sequence length 515
Comment CTA1 SGDID:S000002664, Chr IV from 969677-968130, reverse complement, Verified ORF, "Catalase A, breaks down hydrogen peroxide in the peroxisomal matrix formed by acyl-CoA oxidase (Pox1p) during fatty acid beta-oxidation"
Sequence
MSKLGQEKNEVNYSDVREDRVVTNSTGNPINEPFVTQRIGEHGPLLLQDYNLIDSLAHFN
RENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADT
VRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRDADMFWDF
LTTPENQVAIHQVMILFSDRGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIK
NLTIEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVW
PQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASADPVLQARLFSYADAHR
YRLGPNFHQIPVNCPYASKFFNPAIRDGPMNVNGNFGSEPTYLANDKSYTYIQQDRPIQQ
HQEVWNGPAIPYHWATSPGDVDFVQARNLYRVLGKQPGQQKNLAYNIGIHVEGACPQIQQ
RVYDMFARVDKGLSEAIKKVAEAKHASELSSNSKF
Download sequence
Identical sequences B3LG34 C7GTJ1 E7KB26 H0GE94 P15202
YDR256C YDR256C 4932.YDR256C YDR256C YDR256C SCRT_00270 YDR256C YDR256C YDR256C YDR256c___KOG0047 YDR256C YDR256C YDR256C YDR256C

Jump to [ Top of page · Domain architecture · Domain assignment details ]