SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YDR261C-C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR261C-C
Domain Number - Region: 68-176
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0175
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 
Domain Number - Region: 222-302
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0654
Family HBL-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR261C-C   Protein: S000007394
Sequence length 440
Comment YDR261C-C SGDID:S000007394, Chr IV from 992346-991024, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; in YDRCTY1-3 TYB is mutant and probably non-functional"
Sequence
MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPAS
SAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPM
YFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPND
FPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDI
LSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNN
GIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNY
RRNPSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKS
TTEPIQLNNKHDLHLRPETY
Download sequence
Identical sequences O74302
YDR261C-C 4932.YDR261C-C YDR261C-C YDR261C-C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]